StarFunc result for job id Q99626

User Input

>input (313 residues)
MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQS
PGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPH
HHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQ
VKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAK
ERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVPGSVPGVL
GPTGGVLNPTVTQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99626	0.999	0.999	2.235E-45	313	1.000	1.000	Q99626.pdb.gz	CDX2_HUMAN Homeobox protein CDX-2 OS=Homo sapiens OX=9606 GN=CDX2 PE=1 SV=3
2	AFDB:P52946	0.245	0.268	4.851E-8	284	0.233	0.257	P52946.pdb.gz	PDX1_MOUSE Pancreas/duodenum homeobox protein 1 OS=Mus musculus OX=10090 GN=Pdx1 PE=1 SV=1
3	AFDB:Q00056	0.221	0.217	1.009E-7	320	0.262	0.256	Q00056.pdb.gz	HXA4_HUMAN Homeobox protein Hox-A4 OS=Homo sapiens OX=9606 GN=HOXA4 PE=2 SV=3
4	AFDB:P31268	0.220	0.294	1.152E-7	230	0.236	0.322	P31268.pdb.gz	HXA7_HUMAN Homeobox protein Hox-A7 OS=Homo sapiens OX=9606 GN=HOXA7 PE=1 SV=3
5	AFDB:P41936	0.224	0.204	1.836E-7	346	0.224	0.202	P41936.pdb.gz	HM22_CAEEL Homeobox protein ceh-22 OS=Caenorhabditis elegans OX=6239 GN=ceh-22 PE=2 SV=1
6	AFDB:Q08820	0.216	0.225	2.560E-7	300	0.227	0.237	Q08820.pdb.gz	HXD1_XENLA Homeobox protein Hox-D1 OS=Xenopus laevis OX=8355 GN=hoxd1 PE=2 SV=3
7	AFDB:P09014	0.246	0.276	2.737E-7	275	0.246	0.280	P09014.pdb.gz	HXB5A_DANRE Homeobox protein Hox-B5a OS=Danio rerio OX=7955 GN=hoxb5a PE=2 SV=2
8	AFDB:B8JMG3	0.231	0.204	3.126E-7	356	0.211	0.185	B8JMG3.pdb.gz
9	AFDB:Q9Z2U3	0.212	0.175	4.660E-7	387	0.214	0.173	Q9Z2U3.pdb.gz	Q9Z2U3_MOUSE Homeodomain protein EPX (Fragment) OS=Mus musculus OX=10090 GN=Esx1 PE=2 SV=1
10	AFDB:Q05502	0.225	0.253	6.947E-7	277	0.240	0.271	Q05502.pdb.gz	HHEX_CHICK Hematopoietically-expressed homeobox protein HHEX OS=Gallus gallus OX=9031 GN=HHEX PE=1 SV=1
11	PDB:4egcA	0.158	0.092	2.200E-3	539	0.061	0.035	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.155	0.578	7.000E-2	73	0.051	0.219	2hi3A.pdb.gz
13	PDB:5aj0BZ	0.131	0.399	5.886E-1	86	0.048	0.174	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
14	PDB:5nr5A	0.121	0.305	6.291E-1	113	0.032	0.088	5nr5A.pdb.gz
15	PDB:7fbyA	0.130	0.239	6.291E-1	153	0.035	0.072	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
16	PDB:5mrca	0.095	0.145	1.071	177	0.067	0.119	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
17	PDB:2cg4A	0.127	0.250	1.707	149	0.022	0.047	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
18	PDB:5gadi	0.155	0.110	1.950	450	0.073	0.051	5gadi.pdb.gz	Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
19	PDB:7w59R	0.096	0.107	2.084	280	0.067	0.075	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
20	PDB:4v6iAV	0.108	0.303	2.381	85	0.029	0.106	4v6iAV.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99626	0.0	628	313	1.000	1.000	CDX2_HUMAN Homeobox protein CDX-2 OS=Homo sapiens OX=9606 GN=CDX2 PE=1 SV=3
2	Q9ESV7	2.85e-154	436	310	0.933	0.942	Q9ESV7_RAT Caudal type homeo box 2 OS=Rattus norvegicus OX=10116 GN=Cdx2 PE=3 SV=1
3	P43241	5.70e-154	435	311	0.920	0.926	CDX2_MOUSE Homeobox protein CDX-2 OS=Mus musculus OX=10090 GN=Cdx2 PE=1 SV=1
4	A5PLE8	1.74e-68	216	255	0.438	0.537	A5PLE8_DANRE Caudal type homeobox 1 b OS=Danio rerio OX=7955 GN=zgc:165581 PE=2 SV=1
5	A8KBT9	6.84e-67	212	270	0.441	0.511	A8KBT9_DANRE Caudal type homeo box transcription factor 4 OS=Danio rerio OX=7955 GN=CHUNP6923 PE=2 SV=1
6	Q07424	4.65e-49	167	282	0.371	0.411	CDX4_MOUSE Homeobox protein CDX-4 OS=Mus musculus OX=10090 GN=Cdx4 PE=2 SV=1
7	Q8AXR4	3.57e-45	155	228	0.364	0.500	Q8AXR4_DANRE Caudal type homeobox 1a OS=Danio rerio OX=7955 GN=cdx2 PE=2 SV=2
8	P18111	6.97e-42	147	268	0.233	0.272	CDX1_MOUSE Homeobox protein CDX-1 OS=Mus musculus OX=10090 GN=Cdx1 PE=1 SV=2
9	P47902	1.44e-40	144	265	0.227	0.268	CDX1_HUMAN Homeobox protein CDX-1 OS=Homo sapiens OX=9606 GN=CDX1 PE=1 SV=2
10	O14627	2.38e-40	144	284	0.355	0.391	CDX4_HUMAN Homeobox protein CDX-4 OS=Homo sapiens OX=9606 GN=CDX4 PE=1 SV=1
11	Q05095	1.17e-37	132	123	0.265	0.675	CDX1_RAT Homeobox protein CDX-1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Cdx1 PE=2 SV=1
12	P09085	5.86e-34	130	427	0.201	0.148	CAD_DROME Homeotic protein caudal OS=Drosophila melanogaster OX=7227 GN=cad PE=1 SV=4
13	P34766	6.15e-24	100	270	0.141	0.163	PAL1_CAEEL Homeobox protein pal-1 OS=Caenorhabditis elegans OX=6239 GN=pal-1 PE=1 SV=2
14	P09024	4.69e-22	94.0	217	0.217	0.313	HXB7_MOUSE Homeobox protein Hox-B7 OS=Mus musculus OX=10090 GN=Hoxb7 PE=1 SV=2
15	P09629	7.61e-22	93.6	217	0.211	0.304	HXB7_HUMAN Homeobox protein Hox-B7 OS=Homo sapiens OX=9606 GN=HOXB7 PE=1 SV=4
16	P09067	3.79e-21	92.8	269	0.163	0.190	HXB5_HUMAN Homeobox protein Hox-B5 OS=Homo sapiens OX=9606 GN=HOXB5 PE=1 SV=3
17	P09079	4.28e-21	92.8	269	0.163	0.190	HXB5_MOUSE Homeobox protein Hox-B5 OS=Mus musculus OX=10090 GN=Hoxb5 PE=1 SV=3
18	P06798	2.17e-20	91.3	285	0.141	0.154	HXA4_MOUSE Homeobox protein Hox-A4 OS=Mus musculus OX=10090 GN=Hoxa4 PE=2 SV=4
19	P20719	9.33e-20	89.0	270	0.141	0.163	HXA5_HUMAN Homeobox protein Hox-A5 OS=Homo sapiens OX=9606 GN=HOXA5 PE=1 SV=2
20	P09021	9.52e-20	89.0	270	0.141	0.163	HXA5_MOUSE Homeobox protein Hox-A5 OS=Mus musculus OX=10090 GN=Hoxa5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04731 Caudal_act	1.4e-30	117.8	Caudal like protein activation region
2	PF05920 Homeobox_KN	6.2	18.1	Homeobox KN domain
3	PF00046 Homeodomain	2.4e-17	73.8	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370408

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259915	0.968	POU domain, class 5, transcription factor 1
2	9606.ENSP00000387662	0.932	Glucagon
3	9606.ENSP00000329243	0.875	Keratin, type II cytoskeletal 7
4	9606.ENSP00000167588	0.871	Keratin, type I cytoskeletal 20
5	9606.ENSP00000269216	0.818	Transcription factor GATA-6
6	9606.ENSP00000352926	0.816	Transcriptional enhancer factor TEF-3
7	9606.ENSP00000388620	0.789	Eomesodermin homolog
8	9606.ENSP00000323588	0.784	Transcription factor SOX-2
9	9606.ENSP00000334458	0.766	Transcription factor GATA-4
10	9606.ENSP00000406861	0.765	Mucin-6
11	9606.ENSP00000485659	0.765	Mucin-5AC
12	9606.ENSP00000352257	0.738	X-ray repair cross-complementing protein 6
13	9606.ENSP00000395654	0.735	Transcription activator BRG1
14	9606.ENSP00000297316	0.729	Transcription factor SOX-17
15	9606.ENSP00000168712	0.712	Fibroblast growth factor 4
16	9606.ENSP00000253719	0.709	Napsin-A
17	9606.ENSP00000332973	0.709	Mothers against decapentaplegic homolog 3
18	9606.ENSP00000263334	0.702	Paired box protein Pax-8
19	9606.ENSP00000311010	0.699	ETS-related transcription factor Elf-5
20	9606.ENSP00000245451	0.683	Bone morphogenetic protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000977	1.000	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0005515	0.999	protein binding
GO:0000981	0.998	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000978	0.990	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0036094	0.844	small molecule binding
GO:0008327	0.822	methyl-CpG binding
GO:0001217	0.791	DNA-binding transcription repressor activity
GO:0001227	0.779	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.998	regulation of macromolecule metabolic process
GO:0031323	0.996	regulation of cellular metabolic process
GO:0009889	0.995	regulation of biosynthetic process
GO:0048856	0.982	anatomical structure development
GO:0006355	0.979	regulation of DNA-templated transcription
GO:0048513	0.884	animal organ development
GO:0006357	0.883	regulation of transcription by RNA polymerase II
GO:0048518	0.880	positive regulation of biological process
GO:0032501	0.839	multicellular organismal process
GO:0048522	0.837	positive regulation of cellular process
GO:0048519	0.809	negative regulation of biological process
GO:0009987	0.803	cellular process
GO:0007275	0.791	multicellular organism development
GO:0048523	0.768	negative regulation of cellular process
GO:0009893	0.766	positive regulation of metabolic process
GO:0010604	0.764	positive regulation of macromolecule metabolic process
GO:0051173	0.714	positive regulation of nitrogen compound metabolic process
GO:0031325	0.695	positive regulation of cellular metabolic process
GO:0009892	0.676	negative regulation of metabolic process
GO:0048731	0.671	system development
GO:0010605	0.669	negative regulation of macromolecule metabolic process
GO:0051172	0.649	negative regulation of nitrogen compound metabolic process
GO:0031324	0.647	negative regulation of cellular metabolic process
GO:0009653	0.634	anatomical structure morphogenesis
GO:0045934	0.528	negative regulation of nucleobase-containing compound metabolic process
GO:0045892	0.523	negative regulation of DNA-templated transcription
GO:0045935	0.467	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.466	positive regulation of cellular biosynthetic process
GO:0010557	0.465	positive regulation of macromolecule biosynthetic process
GO:0050896	0.457	response to stimulus
GO:0045893	0.446	positive regulation of DNA-templated transcription
GO:0045944	0.418	positive regulation of transcription by RNA polymerase II
GO:0000122	0.322	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.701	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]