StarFunc result for job id Q99627

User Input

>input (209 residues)
MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRI
PPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFAL
VSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFI
PLSEPAPVPPIPNEQQLARLTDYVAFLEN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R4D1	0.952	0.952	6.962E-30	209	1.000	1.000	A0A024R4D1.pdb.gz
2	PDB:4d10H	0.797	0.958	6.563E-23	173	0.823	0.994	4d10H.pdb.gz	Crystal Structure of the Human Cop9 Signalosome
3	AFDB:E9PGT6	0.648	0.772	2.003E-21	173	0.823	0.994	E9PGT6.pdb.gz	E9PGT6_HUMAN COP9 signalosome subunit 8 OS=Homo sapiens OX=9606 GN=COPS8 PE=1 SV=1
4	AFDB:P43255	0.735	0.777	5.476E-13	197	0.297	0.315	P43255.pdb.gz	CSN8_ARATH COP9 signalosome complex subunit 8 OS=Arabidopsis thaliana OX=3702 GN=CSN8 PE=1 SV=1
5	AFDB:Q75K24	0.721	0.767	1.514E-12	196	0.287	0.306	Q75K24.pdb.gz	CSN8_DICDI COP9 signalosome complex subunit 8 OS=Dictyostelium discoideum OX=44689 GN=csn8 PE=1 SV=1
6	AFDB:Q7KTH8	0.703	0.795	5.523E-10	182	0.239	0.275	Q7KTH8.pdb.gz	CSN8_DROME COP9 signalosome complex subunit 8 OS=Drosophila melanogaster OX=7227 GN=CSN8 PE=1 SV=1
7	AFDB:P50524	0.491	0.394	5.779E-6	270	0.148	0.115	P50524.pdb.gz	RPN12_SCHPO 26S proteasome regulatory subunit rpn12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpn12 PE=1 SV=1
8	AFDB:Q9V436	0.504	0.412	2.657E-5	264	0.158	0.125	Q9V436.pdb.gz	Q9V436_DROME 26S proteasome non-ATPase regulatory subunit 8 OS=Drosophila melanogaster OX=7227 GN=Rpn12 PE=1 SV=1
9	AFDB:Q23449	0.590	0.505	3.257E-5	250	0.153	0.128	Q23449.pdb.gz	PSMD8_CAEEL 26S proteasome non-ATPase regulatory subunit 8 OS=Caenorhabditis elegans OX=6239 GN=rpn-12 PE=3 SV=1
10	AFDB:Q9CX56	0.510	0.323	3.427E-5	353	0.120	0.071	Q9CX56.pdb.gz	PSMD8_MOUSE 26S proteasome non-ATPase regulatory subunit 8 OS=Mus musculus OX=10090 GN=Psmd8 PE=1 SV=2
11	AFDB:Q9FHY0	0.563	0.513	3.793E-5	233	0.144	0.129	Q9FHY0.pdb.gz	PSD8B_ARATH Putative 26S proteasome non-ATPase regulatory subunit 8 homolog B OS=Arabidopsis thaliana OX=3702 GN=RPN12B PE=5 SV=2
12	PDB:5l4kT	0.484	0.392	1.815E-4	272	0.129	0.099	5l4kT.pdb.gz
13	PDB:4cr2T	0.489	0.395	3.342E-4	272	0.115	0.088	4cr2T.pdb.gz	Deep Classification of a Large Cryo-Em Dataset Defines the Conformational Landscape of the 26S Proteasome.
14	PDB:3jckF	0.217	0.135	6.152E-4	388	0.196	0.106	3jckF.pdb.gz	Atomic structure of the 26S proteasome lid reveals the mechanism of deubiquitinase inhibition.
15	PDB:6r7nB	0.452	0.255	1.023E-3	443	0.148	0.070	6r7nB.pdb.gz	Structural basis of Cullin 2 RING E3 ligase regulation by the COP9 signalosome.
16	PDB:3jckD	0.522	0.316	1.460E-3	384	0.134	0.073	3jckD.pdb.gz	Atomic structure of the 26S proteasome lid reveals the mechanism of deubiquitinase inhibition.
17	PDB:6fvtR	0.471	0.276	1.883E-3	405	0.120	0.062	6fvtR.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
18	PDB:3txmA	0.483	0.313	2.555E-3	353	0.086	0.051	3txmA.pdb.gz
19	PDB:5l4kR	0.489	0.294	5.207E-3	389	0.105	0.057	5l4kR.pdb.gz
20	PDB:5mpbP	0.253	0.131	7.822E-3	440	0.167	0.080	5mpbP.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99627	2.95e-155	429	209	1.000	1.000	CSN8_HUMAN COP9 signalosome complex subunit 8 OS=Homo sapiens OX=9606 GN=COPS8 PE=1 SV=1
2	Q8VBV7	1.34e-149	415	209	0.952	0.952	CSN8_MOUSE COP9 signalosome complex subunit 8 OS=Mus musculus OX=10090 GN=Cops8 PE=1 SV=1
3	E9PGT6	6.88e-121	341	173	0.828	1.000	E9PGT6_HUMAN COP9 signalosome subunit 8 OS=Homo sapiens OX=9606 GN=COPS8 PE=1 SV=1
4	P43255	3.15e-31	114	197	0.306	0.325	CSN8_ARATH COP9 signalosome complex subunit 8 OS=Arabidopsis thaliana OX=3702 GN=CSN8 PE=1 SV=1
5	Q75K24	4.97e-31	114	196	0.292	0.311	CSN8_DICDI COP9 signalosome complex subunit 8 OS=Dictyostelium discoideum OX=44689 GN=csn8 PE=1 SV=1
6	Q7KTH8	5.71e-14	69.3	182	0.254	0.291	CSN8_DROME COP9 signalosome complex subunit 8 OS=Drosophila melanogaster OX=7227 GN=CSN8 PE=1 SV=1
7	P35688	5.3	30.4	1017	0.144	0.029	LRG1_YEAST Rho-GTPase-activating protein LRG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LRG1 PE=1 SV=3
8	Q8CIS9	5.8	30.4	618	0.110	0.037	K1C9_RAT Keratin, type I cytoskeletal 9 OS=Rattus norvegicus OX=10116 GN=Krt9 PE=1 SV=1
9	P33202	6.2	30.4	1483	0.100	0.014	UFD4_YEAST Ubiquitin fusion degradation protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UFD4 PE=1 SV=1
10	G1K109	7.6	30.0	876	0.062	0.015	G1K109_CAEEL Basement membrane-specific heparan sulfate proteoglycan core protein OS=Caenorhabditis elegans OX=6239 GN=unc-52 PE=1 SV=1
11	Q5AS68	7.8	30.0	1569	0.110	0.015	Q5AS68_EMENI Aspergillus nidulans myosin V homolog (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08862 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10075 CSN8_PSD8_EIF3K	2.2e-34	130.0	CSN8/PSMD8/EIF3K family
2	PF01399 PCI	87	15.1	PCI domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 27679.XP_003936796.1

Rank	PPI partner	STRING score	Description
1	27679.XP_003929461.1	0.999	COP9 signalosome complex subunit 3
2	27679.XP_010333216.1	0.999	COP9 signalosome complex subunit 4
3	27679.XP_003928919.1	0.998	COP9 signalosome complex subunit 2 isoform X1
4	27679.XP_003934253.1	0.998	COP9 signalosome complex subunit 6
5	27679.XP_003942946.1	0.998	COP9 signalosome complex subunit 5 isoform X1
6	27679.XP_010328347.1	0.997	COP9 signalosome complex subunit 7a
7	27679.XP_010340576.1	0.997	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 192 ESTs, 1 Protein, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns
8	27679.XP_003930657.1	0.984	COP9 signalosome complex subunit 7b isoform X1
9	27679.XP_010341718.1	0.971	E3 ubiquitin-protein ligase RBX1
10	27679.XP_003928309.2	0.965	Belongs to the cullin family. ProRule:PRU00330, ECO:0000256\|RuleBase:RU003829,
11	27679.XP_010340008.1	0.958	Belongs to the cullin family. ProRule:PRU00330, ECO:0000256\|RuleBase:RU003829,
12	27679.XP_010332436.1	0.935	DNA damage-binding protein 2 isoform X2
13	27679.XP_010345168.1	0.929	Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades.
14	27679.XP_010347391.1	0.926	Belongs to the cullin family. ProRule:PRU00330, ECO:0000256\|RuleBase:RU003829,
15	27679.XP_003924339.1	0.916	NEDD8
16	27679.XP_003926408.1	0.916	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 127 ESTs, 3 Proteins, and 84% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns
17	27679.XP_010344205.1	0.894	WD and tetratricopeptide repeats protein 1 isoform X1
18	27679.XP_010333656.1	0.893	DNA damage-binding protein 1
19	27679.XP_003933069.1	0.881	26S proteasome non-ATPase regulatory subunit 11
20	27679.XP_003928143.1	0.872	DDB1- and CUL4-associated factor 6 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0019538	0.990	protein metabolic process
GO:0009987	0.989	cellular process
GO:0044237	0.981	cellular metabolic process
GO:0050794	0.975	regulation of cellular process
GO:0019222	0.970	regulation of metabolic process
GO:0080090	0.964	regulation of primary metabolic process
GO:0060255	0.964	regulation of macromolecule metabolic process
GO:0051171	0.962	regulation of nitrogen compound metabolic process
GO:0006508	0.954	proteolysis
GO:0070647	0.952	protein modification by small protein conjugation or removal
GO:0050896	0.936	response to stimulus
GO:0070646	0.928	protein modification by small protein removal
GO:0051246	0.900	regulation of protein metabolic process
GO:0048518	0.897	positive regulation of biological process
GO:0000338	0.875	protein deneddylation
GO:0051173	0.869	positive regulation of nitrogen compound metabolic process
GO:0010604	0.865	positive regulation of macromolecule metabolic process
GO:0031323	0.855	regulation of cellular metabolic process
GO:0051716	0.849	cellular response to stimulus
GO:0048522	0.840	positive regulation of cellular process
GO:0031325	0.773	positive regulation of cellular metabolic process
GO:0048523	0.620	negative regulation of cellular process
GO:0051247	0.620	positive regulation of protein metabolic process
GO:0007154	0.608	cell communication
GO:0007165	0.588	signal transduction
GO:0031399	0.562	regulation of protein modification process
GO:0031401	0.501	positive regulation of protein modification process
GO:0035556	0.476	intracellular signal transduction
GO:0065009	0.455	regulation of molecular function
GO:0038061	0.363	NIK/NF-kappaB signaling
GO:0071840	0.353	cellular component organization or biogenesis
GO:0042127	0.321	regulation of cell population proliferation
GO:0006468	0.321	protein phosphorylation
GO:0045860	0.317	positive regulation of protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.999	nucleoplasm
GO:0032991	0.998	protein-containing complex
GO:0140513	0.824	nuclear protein-containing complex
GO:0005576	0.579	extracellular region
GO:0008180	0.541	COP9 signalosome
GO:0031982	0.526	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]