StarFunc result for job id Q99633

User Input

>input (342 residues)
MDILKSEILRKRQLVEDRNLLVENKKYFKRSELAKKEEEAYFERCGYKIQPKEEDQKPLT
SSNPVLELELAEEKLPMTLSRQEVIRRLRERGEPIRLFGETDYDAFQRLRKIEILTPEVN
KGLRNDLKAALDKIDQQYLNEIVGGQEPGEEDTQNDLKVHEENTTIEELEALGESLGKGD
DHKDMDIITKFLKFLLGVWAKELNAREDYVKRSVQGKLNSATQKQTESYLRPLFRKLRKR
NLPADIKESITDIIKFMLQREYVKANDAYLQMAIGNAPWPIGVTMVGIHARTGREKIFSK
HVAHVLNDETQRKYIQGLKRLMTICQKHFPTDPSKCVEYNAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99633	1.000	1.000	3.540E-46	342	1.000	1.000	Q99633.pdb.gz	PRP18_HUMAN Pre-mRNA-splicing factor 18 OS=Homo sapiens OX=9606 GN=PRPF18 PE=1 SV=1
2	AFDB:Q9SA55	0.516	0.424	3.195E-20	420	0.395	0.321	Q9SA55.pdb.gz	Q9SA55_ARATH Pre-mRNA-splicing factor 18 OS=Arabidopsis thaliana OX=3702 GN=PRP18A PE=1 SV=1
3	AFDB:O94406	0.429	0.428	8.219E-13	343	0.278	0.277	O94406.pdb.gz	PRP18_SCHPO Pre-mRNA-splicing factor 18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp18 PE=3 SV=1
4	PDB:6exna	0.367	0.698	1.343E-5	171	0.135	0.269	6exna.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
5	PDB:5wsgf	0.271	0.591	5.038E-3	148	0.108	0.250	5wsgf.pdb.gz	Structure of a yeast step II catalytically activated spliceosome
6	AFDB:Q7L8J4	0.126	0.113	8.959E-2	393	0.123	0.107	Q7L8J4.pdb.gz	3BP5L_HUMAN SH3 domain-binding protein 5-like OS=Homo sapiens OX=9606 GN=SH3BP5L PE=1 SV=1
7	AFDB:A2ALU4	0.122	0.044	1.680E-1	1481	0.175	0.041	A2ALU4.pdb.gz	SHRM2_MOUSE Protein Shroom2 OS=Mus musculus OX=10090 GN=Shroom2 PE=1 SV=1
8	AFDB:P34445	0.092	0.099	1.680E-1	307	0.143	0.160	P34445.pdb.gz	YL87_CAEEL Uncharacterized protein F54C8.7 OS=Caenorhabditis elegans OX=6239 GN=F54C8.7 PE=4 SV=3
9	AFDB:P24814	0.155	0.058	2.406E-1	1151	0.117	0.035	P24814.pdb.gz	GRR1_YEAST SCF E3 ubiquitin ligase complex F-box protein GRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GRR1 PE=1 SV=1
10	AFDB:O64614	0.140	0.159	2.632E-1	281	0.099	0.121	O64614.pdb.gz	YIP4A_ARATH Protein YIP4a OS=Arabidopsis thaliana OX=3702 GN=YIP4A PE=1 SV=1
11	PDB:5zlfA	0.136	0.151	3.752E-1	293	0.091	0.106	5zlfA.pdb.gz	Discovery of Lipophilic Bisphosphonates That Target Bacterial Cell Wall and Quinone Biosynthesis.
12	AFDB:Q09232	0.122	0.138	5.161E-1	293	0.111	0.130	Q09232.pdb.gz	ORAI_CAEEL Protein orai OS=Caenorhabditis elegans OX=6239 GN=orai-1 PE=2 SV=1
13	AFDB:Q584V7	0.103	0.108	5.906E-1	324	0.120	0.127	Q584V7.pdb.gz	Q584V7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4M18.80 PE=4 SV=1
14	PDB:5zlfB	0.146	0.171	1.380	259	0.082	0.108	5zlfB.pdb.gz	Discovery of Lipophilic Bisphosphonates That Target Bacterial Cell Wall and Quinone Biosynthesis.
15	PDB:5iztA	0.100	0.153	1.579	211	0.056	0.090	5iztA.pdb.gz
16	PDB:3lsjA	0.121	0.165	1.727	205	0.094	0.156	3lsjA.pdb.gz	Structural basis for the transcriptional regulation of membrane lipid homeostasis.
17	PDB:6hu9c	0.196	0.236	2.474	269	0.085	0.108	6hu9c.pdb.gz	Structure of yeast cytochrome c oxidase in a supercomplex with cytochrome bc1.
18	PDB:6hb3B	0.119	0.114	2.830	360	0.067	0.064	6hb3B.pdb.gz
19	PDB:7pmkX	0.124	0.080	2.830	665	0.132	0.068	7pmkX.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
20	PDB:4xwhA	0.139	0.080	3.387	720	0.053	0.025	4xwhA.pdb.gz	Structural characterization of the alpha-N-acetylglucosaminidase, a key enzyme in the pathogenesis of Sanfilippo syndrome B.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99633	0.0	701	342	1.000	1.000	PRP18_HUMAN Pre-mRNA-splicing factor 18 OS=Homo sapiens OX=9606 GN=PRPF18 PE=1 SV=1
2	Q9JKB8	0.0	697	342	0.988	0.988	PRP18_RAT Pre-mRNA-splicing factor 18 OS=Rattus norvegicus OX=10116 GN=Prpf18 PE=2 SV=1
3	Q9SA55	1.06e-62	207	420	0.333	0.271	Q9SA55_ARATH Pre-mRNA-splicing factor 18 OS=Arabidopsis thaliana OX=3702 GN=PRP18A PE=1 SV=1
4	O94406	7.27e-26	107	343	0.298	0.297	PRP18_SCHPO Pre-mRNA-splicing factor 18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp18 PE=3 SV=1
5	P33411	7.77e-11	63.9	251	0.111	0.151	PRP18_YEAST Pre-mRNA-splicing factor 18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRP18 PE=1 SV=3
6	A0A384MDT9	1.3	32.3	157	0.088	0.191	A0A384MDT9_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
7	Q86SX6	1.3	32.3	157	0.088	0.191	GLRX5_HUMAN Glutaredoxin-related protein 5, mitochondrial OS=Homo sapiens OX=9606 GN=GLRX5 PE=1 SV=2
8	P39321	2.6	32.7	1259	0.082	0.022	TAMB_ECOLI Translocation and assembly module subunit TamB OS=Escherichia coli (strain K12) OX=83333 GN=tamB PE=1 SV=2
9	P50521	2.6	32.3	455	0.064	0.048	HXK2_SCHPO Hexokinase-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hxk2 PE=1 SV=1
10	O22212	3.7	32.0	554	0.064	0.040	PRP4L_ARATH U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana OX=3702 GN=LIS PE=2 SV=1
11	Q5CZC0	5.3	31.6	6907	0.053	0.003	FSIP2_HUMAN Fibrous sheath-interacting protein 2 OS=Homo sapiens OX=9606 GN=FSIP2 PE=2 SV=4
12	Q80Y14	6.3	30.0	152	0.076	0.171	GLRX5_MOUSE Glutaredoxin-related protein 5, mitochondrial OS=Mus musculus OX=10090 GN=Glrx5 PE=1 SV=2
13	C8VT14	8.0	31.2	1313	0.123	0.032	C8VT14_EMENI MAP kinase kinase kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sskB PE=3 SV=1
14	D4ADD7	8.5	30.4	214	0.076	0.121	D4ADD7_RAT Glutaredoxin 5 OS=Rattus norvegicus OX=10116 GN=Glrx5 PE=4 SV=2
15	Q6PH45	8.6	30.8	507	0.053	0.036	Q6PH45_DANRE PRP4 pre-mRNA-processing factor 4 homolog (yeast) OS=Danio rerio OX=7955 GN=mg:ab03a02 PE=1 SV=1
16	P39288	8.9	30.4	379	0.047	0.042	QUEG_ECOLI Epoxyqueuosine reductase OS=Escherichia coli (strain K12) OX=83333 GN=queG PE=3 SV=1
17	O60437	9.6	30.8	1756	0.056	0.011	PEPL_HUMAN Periplakin OS=Homo sapiens OX=9606 GN=PPL PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02840 Prp18	2.5e-59	211.0	Prp18 domain
2	PF08799 PRP4	3.3e-10	50.6	pre-mRNA processing factor 4 (PRP4) like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 79684.XP_005354904.1

Rank	PPI partner	STRING score	Description
1	79684.XP_005364545.1	0.996	U5 small nuclear ribonucleoprotein 200 kDa helicase
2	79684.XP_005368241.1	0.994	pre-mRNA-splicing factor SLU7 isoform X1
3	79684.XP_005349606.1	0.993	pre-mRNA-processing-splicing factor 8 isoform X1
4	79684.XP_005369150.1	0.988	116 kDa U5 small nuclear ribonucleoprotein component
5	79684.XP_005357015.1	0.981	U4/U6 small nuclear ribonucleoprotein Prp3
6	79684.XP_005369211.1	0.980	ATP-dependent RNA helicase DHX8
7	79684.XP_005360248.1	0.977	Small nuclear ribonucleoprotein Sm D3 isoform X1
8	79684.XP_005365685.1	0.976	Small nuclear ribonucleoprotein-associated proteins B and B' isoform X1
9	79684.XP_005371936.1	0.976	Small nuclear ribonucleoprotein-associated protein N-like isoform X1
10	79684.XP_005359650.1	0.974	Small nuclear ribonucleoprotein Sm D2-like
11	79684.XP_005370328.1	0.974	Small nuclear ribonucleoprotein Sm D2
12	79684.XP_005363053.1	0.972	Probable ATP-dependent RNA helicase DHX35 isoform X1
13	79684.XP_005359880.1	0.968	Cell division cycle 5-like protein
14	79684.XP_005347004.1	0.967	Small nuclear ribonucleoprotein E-like
15	79684.XP_005348420.1	0.967	Small nuclear ribonucleoprotein E
16	79684.XP_005359349.1	0.967	Small nuclear ribonucleoprotein E-like
17	79684.XP_005361945.1	0.965	Protein phosphatase 1 regulatory subunit 42
18	79684.XP_005363567.1	0.965	Small nuclear ribonucleoprotein G-like
19	79684.XP_005364851.1	0.965	Small nuclear ribonucleoprotein G
20	79684.XP_005349841.1	0.961	LSM domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.419	organic cyclic compound binding
GO:0003676	0.414	nucleic acid binding
GO:0003723	0.381	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.994	cellular metabolic process
GO:0044238	0.993	primary metabolic process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0043170	0.985	macromolecule metabolic process
GO:0016071	0.981	mRNA metabolic process
GO:0006396	0.976	RNA processing
GO:0006397	0.973	mRNA processing
GO:0008380	0.969	RNA splicing
GO:0050789	0.942	regulation of biological process
GO:0060255	0.934	regulation of macromolecule metabolic process
GO:0051171	0.844	regulation of nitrogen compound metabolic process
GO:0080090	0.843	regulation of primary metabolic process
GO:0048519	0.805	negative regulation of biological process
GO:0051246	0.696	regulation of protein metabolic process
GO:0000375	0.602	RNA splicing, via transesterification reactions
GO:0000398	0.579	mRNA splicing, via spliceosome
GO:0009892	0.507	negative regulation of metabolic process
GO:0050794	0.433	regulation of cellular process
GO:0010605	0.392	negative regulation of macromolecule metabolic process
GO:0051172	0.332	negative regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0032991	0.995	protein-containing complex
GO:0005634	0.993	nucleus
GO:0016020	0.984	membrane
GO:0005681	0.967	spliceosomal complex
GO:0031981	0.936	nuclear lumen
GO:0005654	0.888	nucleoplasm
GO:1902494	0.722	catalytic complex
GO:0005737	0.691	cytoplasm
GO:0005684	0.487	U2-type spliceosomal complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]