StarFunc result for job id Q99640

User Input

>input (499 residues)
MLERPPALAMPMPTEGTPPPLSGTPIPVPAYFRHAEPGFSLKRPRGLSRSLPPPPPAKGS
IPISRLFPPRTPGWHQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGS
YGEVFKVRSKEDGRLYAVKRSMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEG
GILYLQTELCGPSLQQHCEAWGASLPEAQVWGYLRDTLLALAHLHSQGLVHLDVKPANIF
LGPRGRCKLGDFGLLVELGTAGAGEVQEGDPRYMAPELLQGSYGTAADVFSLGLTILEVA
CNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATAEALLALPVLR
QPRAWGVLWCMAAEALSRGWALWQALLALLCWLWHGLAHPASWLQPLGPPATPPGSPPCS
LLLDSSLSSNWDDDSLGPSLSPEAVLARTVGSTSTPRSRCTPRDALDLSDINSEPPRGSF
PSFEPRNLLSLFEDTLDPT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99640	1.000	1.000	9.339E-89	499	1.000	1.000	Q99640.pdb.gz	PMYT1_HUMAN Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Homo sapiens OX=9606 GN=PKMYT1 PE=1 SV=1
2	AFDB:Q9ESG9	0.724	0.737	2.696E-74	490	0.878	0.894	Q9ESG9.pdb.gz	PMYT1_MOUSE Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Mus musculus OX=10090 GN=Pkmyt1 PE=2 SV=3
3	AFDB:Q9NI63	0.557	0.522	4.427E-37	533	0.343	0.321	Q9NI63.pdb.gz	PMYT1_DROME Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Drosophila melanogaster OX=7227 GN=Myt1 PE=1 SV=2
4	AFDB:O18209	0.559	0.416	1.563E-33	677	0.313	0.230	O18209.pdb.gz	PMY13_CAEEL Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.3 OS=Caenorhabditis elegans OX=6239 GN=wee-1.3 PE=1 SV=1
5	AFDB:A4PES0	0.475	0.421	3.646E-25	565	0.259	0.228	A4PES0.pdb.gz	WEE2_PIG Wee1-like protein kinase 2 OS=Sus scrofa OX=9823 GN=WEE2 PE=1 SV=2
6	AFDB:P0C1S8	0.485	0.428	7.585E-25	567	0.261	0.229	P0C1S8.pdb.gz	WEE2_HUMAN Wee1-like protein kinase 2 OS=Homo sapiens OX=9606 GN=WEE2 PE=1 SV=2
7	AFDB:Q66JT0	0.475	0.428	8.489E-25	555	0.263	0.236	Q66JT0.pdb.gz	WEE2_MOUSE Wee1-like protein kinase 2 OS=Mus musculus OX=10090 GN=Wee2 PE=1 SV=2
8	AFDB:P47817	0.503	0.456	1.976E-24	555	0.259	0.232	P47817.pdb.gz	WEE2A_XENLA Wee1-like protein kinase 2-A OS=Xenopus laevis OX=8355 GN=wee2-a PE=1 SV=2
9	AFDB:P30291	0.496	0.386	5.449E-24	646	0.265	0.204	P30291.pdb.gz	WEE1_HUMAN Wee1-like protein kinase OS=Homo sapiens OX=9606 GN=WEE1 PE=1 SV=2
10	AFDB:Q8QGV2	0.494	0.417	9.047E-24	595	0.265	0.222	Q8QGV2.pdb.gz	WEE1B_XENLA Wee1-like protein kinase 1-B OS=Xenopus laevis OX=8355 GN=wee1-b PE=1 SV=1
11	PDB:4eomC	0.447	0.779	1.761E-18	276	0.164	0.297	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
12	PDB:1unlA	0.446	0.741	3.874E-18	292	0.144	0.247	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
13	PDB:4yc3A	0.451	0.738	6.433E-18	295	0.140	0.237	4yc3A.pdb.gz
14	PDB:5u6yA	0.449	0.486	1.585E-17	459	0.170	0.185	5u6yA.pdb.gz
15	PDB:4krcA	0.438	0.719	2.783E-17	297	0.146	0.246	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
16	PDB:4gcjA	0.440	0.703	6.480E-17	304	0.166	0.273	4gcjA.pdb.gz	Development of highly potent and selective diaminothiazole inhibitors of cyclin-dependent kinases.
17	PDB:7qwkH	0.427	0.791	8.118E-17	259	0.164	0.317	7qwkH.pdb.gz	The structure of human GCN2 reveals a parallel, back-to-back kinase dimer with a plastic DFG activation loop motif.
18	PDB:4zhxA	0.428	0.516	9.613E-17	409	0.136	0.166	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
19	PDB:6b1uA	0.436	0.489	9.613E-17	442	0.158	0.179	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
20	PDB:4ek6A	0.422	0.732	1.138E-16	279	0.162	0.290	4ek6A.pdb.gz	Crystal structure of the cdk2 in complex with aminopyrazole inhibitor

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99640	0.0	993	499	1.000	1.000	PMYT1_HUMAN Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Homo sapiens OX=9606 GN=PKMYT1 PE=1 SV=1
2	Q9ESG9	0.0	846	490	0.878	0.894	PMYT1_MOUSE Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Mus musculus OX=10090 GN=Pkmyt1 PE=2 SV=3
3	O18209	1.53e-78	260	677	0.255	0.188	PMY13_CAEEL Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.3 OS=Caenorhabditis elegans OX=6239 GN=wee-1.3 PE=1 SV=1
4	Q9NI63	1.62e-77	254	533	0.251	0.235	PMYT1_DROME Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Drosophila melanogaster OX=7227 GN=Myt1 PE=1 SV=2
5	Q20085	3.05e-51	183	468	0.194	0.207	PMY11_CAEEL Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.1 OS=Caenorhabditis elegans OX=6239 GN=wee-1.1 PE=2 SV=2
6	P07527	4.62e-44	168	877	0.206	0.117	WEE1_SCHPO Mitosis inhibitor protein kinase wee1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wee1 PE=1 SV=1
7	P47810	1.75e-42	162	646	0.214	0.166	WEE1_MOUSE Wee1-like protein kinase OS=Mus musculus OX=10090 GN=Wee1 PE=1 SV=2
8	Q1LYE1	4.97e-42	160	612	0.194	0.158	Q1LYE1_DANRE Wee1-like protein kinase OS=Danio rerio OX=7955 GN=fa20h03 PE=1 SV=1
9	Q6DRI0	2.42e-41	158	612	0.194	0.158	Q6DRI0_DANRE Wee1-like protein kinase OS=Danio rerio OX=7955 GN=fa20h03 PE=1 SV=1
10	P30291	7.55e-40	154	646	0.200	0.155	WEE1_HUMAN Wee1-like protein kinase OS=Homo sapiens OX=9606 GN=WEE1 PE=1 SV=2
11	Q8QGV2	1.01e-39	154	595	0.198	0.166	WEE1B_XENLA Wee1-like protein kinase 1-B OS=Xenopus laevis OX=8355 GN=wee1-b PE=1 SV=1
12	G5EB22	5.02e-39	154	1050	0.170	0.081	G5EB22_EMENI Protein kinase domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05822 PE=4 SV=1
13	A4PES0	9.07e-39	150	565	0.188	0.166	WEE2_PIG Wee1-like protein kinase 2 OS=Sus scrofa OX=9823 GN=WEE2 PE=1 SV=2
14	Q66JT0	1.19e-37	147	555	0.190	0.171	WEE2_MOUSE Wee1-like protein kinase 2 OS=Mus musculus OX=10090 GN=Wee2 PE=1 SV=2
15	P0C1S8	3.43e-37	146	567	0.186	0.164	WEE2_HUMAN Wee1-like protein kinase 2 OS=Homo sapiens OX=9606 GN=WEE2 PE=1 SV=2
16	P47817	2.70e-35	140	555	0.190	0.171	WEE2A_XENLA Wee1-like protein kinase 2-A OS=Xenopus laevis OX=8355 GN=wee2-a PE=1 SV=2
17	Q8L4H0	4.44e-35	139	500	0.178	0.178	WEE1_ARATH Wee1-like protein kinase OS=Arabidopsis thaliana OX=3702 GN=WEE1 PE=1 SV=1
18	P54350	6.78e-35	140	609	0.180	0.148	WEE1_DROME Wee1-like protein kinase OS=Drosophila melanogaster OX=7227 GN=Wee1 PE=1 SV=2
19	P32944	8.78e-30	125	819	0.146	0.089	SWE1_YEAST Mitosis inhibitor protein kinase SWE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SWE1 PE=1 SV=1
20	P30290	2.15e-27	117	581	0.178	0.153	MIK1_SCHPO Mitosis inhibitor protein kinase mik1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mik1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	63	14.1	ABC1 atypical kinase-like domain
2	PF14531 Kinase-like	2e-06	38.9	Kinase-like
3	PF00069 Pkinase	7.4e-42	155.1	Protein kinase domain
4	PF07714 PK_Tyr_Ser-Thr	1.6e-16	72.0	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262300

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256442	0.997	G2/mitotic-specific cyclin-B1
2	9606.ENSP00000378699	0.997	Cyclin-dependent kinase 1
3	9606.ENSP00000300093	0.995	Serine/threonine-protein kinase PLK1
4	9606.ENSP00000274026	0.994	Cyclin-A2
5	9606.ENSP00000288207	0.994	G2/mitotic-specific cyclin-B2
6	9606.ENSP00000303706	0.961	M-phase inducer phosphatase 1
7	9606.ENSP00000321656	0.943	M-phase inducer phosphatase 3
8	9606.ENSP00000361540	0.935	Cell division cycle protein 20 homolog
9	9606.ENSP00000255465	0.933	Cyclin-A1
10	9606.ENSP00000245960	0.926	M-phase inducer phosphatase 2
11	9606.ENSP00000319169	0.913	Protein arginine N-methyltransferase 5
12	9606.ENSP00000311083	0.872	Cyclin-dependent kinases regulatory subunit 1
13	9606.ENSP00000376822	0.864	Metalloreductase STEAP3
14	9606.ENSP00000364976	0.858	Cyclin-dependent kinases regulatory subunit 2
15	9606.ENSP00000388648	0.856	Serine/threonine-protein kinase Chk1
16	9606.ENSP00000310722	0.845	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family
17	9606.ENSP00000435412	0.827	Ribosomal protein S6 kinase alpha-1
18	9606.ENSP00000370003	0.819	BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like
19	9606.ENSP00000427015	0.817	Ribosomal protein S6 kinase alpha-2
20	9606.ENSP00000368884	0.813	Ribosomal protein S6 kinase alpha-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0051726	0.983	regulation of cell cycle
GO:0007049	0.919	cell cycle
GO:0007346	0.868	regulation of mitotic cell cycle
GO:0010564	0.860	regulation of cell cycle process
GO:0000086	0.857	G2/M transition of mitotic cell cycle
GO:0019222	0.856	regulation of metabolic process
GO:0051338	0.855	regulation of transferase activity
GO:0051783	0.851	regulation of nuclear division
GO:0060255	0.810	regulation of macromolecule metabolic process
GO:0042325	0.810	regulation of phosphorylation
GO:1904029	0.802	regulation of cyclin-dependent protein kinase activity
GO:0000079	0.785	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0007088	0.716	regulation of mitotic nuclear division
GO:0071704	0.630	organic substance metabolic process
GO:0044238	0.630	primary metabolic process
GO:0006807	0.615	nitrogen compound metabolic process
GO:0044237	0.600	cellular metabolic process
GO:0043170	0.552	macromolecule metabolic process
GO:0050896	0.505	response to stimulus
GO:1901564	0.480	organonitrogen compound metabolic process
GO:0019538	0.464	protein metabolic process
GO:0048518	0.427	positive regulation of biological process
GO:0048519	0.410	negative regulation of biological process
GO:0048523	0.401	negative regulation of cellular process
GO:0051716	0.364	cellular response to stimulus
GO:0048522	0.339	positive regulation of cellular process
GO:0036211	0.330	protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.995	nucleoplasm
GO:0043232	0.983	intracellular non-membrane-bounded organelle
GO:0005829	0.972	cytosol
GO:0016020	0.715	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]