StarFunc result for job id Q99643

User Input

>input (169 residues)
MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNRPLSPHITIYS
WSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYLELVKSLCLGPALIHTAKFAL
VFPLMYHTWNGIRHLMWDLGKGLKIPQLYQSGVVVLVLTVLSSMGLAAM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35720	0.851	0.851	5.435E-24	169	0.899	0.899	P35720.pdb.gz	C560_BOVIN Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Bos taurus OX=9913 GN=SDHC PE=1 SV=2
2	AFDB:D0VWV4	0.792	0.792	7.380E-24	169	0.917	0.917	D0VWV4.pdb.gz	C560_PIG Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Sus scrofa OX=9823 GN=SDHC PE=1 SV=2
3	AFDB:Q9CZB0	0.798	0.798	1.709E-21	169	0.799	0.799	Q9CZB0.pdb.gz	C560_MOUSE Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Mus musculus OX=10090 GN=Sdhc PE=1 SV=1
4	PDB:4ytpC	0.807	0.986	1.279E-18	138	0.740	0.906	4ytpC.pdb.gz	Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
5	AFDB:Q8MYW1	0.757	0.749	6.031E-11	171	0.355	0.351	Q8MYW1.pdb.gz	Q8MYW1_DROME RH04289p OS=Drosophila melanogaster OX=7227 GN=SdhC PE=2 SV=1
6	AFDB:O74882	0.699	0.660	1.112E-10	180	0.337	0.317	O74882.pdb.gz	SDH3_SCHPO Succinate dehydrogenase cytochrome B subunit, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sdh3 PE=3 SV=1
7	AFDB:Q2U3V9	0.680	0.615	1.744E-9	188	0.314	0.282	Q2U3V9.pdb.gz	Q2U3V9_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090020000596 PE=4 SV=1
8	AFDB:Q8T2T5	0.703	0.623	1.744E-9	192	0.325	0.286	Q8T2T5.pdb.gz	C560_DICDI Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=sdhC PE=3 SV=1
9	AFDB:P41956	0.743	0.693	1.971E-9	182	0.272	0.253	P41956.pdb.gz	C560_CAEEL Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=mev-1 PE=2 SV=1
10	AFDB:Q5ALU6	0.656	0.633	1.484E-8	176	0.296	0.284	Q5ALU6.pdb.gz	Q5ALU6_CANAL Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C201690WA PE=4 SV=1
11	AFDB:Q04487	0.630	0.549	1.118E-7	196	0.243	0.209	Q04487.pdb.gz	SHH3_YEAST Mitochondrial inner membrane protein SHH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SHH3 PE=3 SV=1
12	PDB:2aczC	0.545	0.691	5.797E-5	129	0.160	0.209	2aczC.pdb.gz	Structural and computational analysis of the quinone-binding site of complex II (succinate-ubiquinone oxidoreductase): a mechanism of electron transfer and proton conduction during ubiquinone reduction.
13	PDB:6lo8C	0.495	0.723	1.577E-3	108	0.142	0.222	6lo8C.pdb.gz
14	PDB:2aczD	0.317	0.431	4.958E-1	113	0.130	0.195	2aczD.pdb.gz	Structural and computational analysis of the quinone-binding site of complex II (succinate-ubiquinone oxidoreductase): a mechanism of electron transfer and proton conduction during ubiquinone reduction.
15	PDB:2b76D	0.342	0.426	4.958E-1	119	0.130	0.185	2b76D.pdb.gz	Fumarate Reductase and Succinate Oxidase Activity of Escherichia coli Complex II Homologs Are Perturbed Differently by Mutation of the Flavin Binding Domain
16	PDB:6s7oD	0.227	0.309	6.732E-1	110	0.101	0.155	6s7oD.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.
17	PDB:7x5hR	0.345	0.235	1.168	274	0.112	0.069	7x5hR.pdb.gz	Structural insights into the ligand binding and G i coupling of serotonin receptor 5-HT 5A .
18	PDB:7xw5R	0.315	0.120	2.025	572	0.130	0.038	7xw5R.pdb.gz	Hormone- and antibody-mediated activation of the thyrotropin receptor.
19	PDB:6zpoa	0.194	0.151	2.153	226	0.095	0.071	6zpoa.pdb.gz	Structure of the dimeric ATP synthase from bovine mitochondria.
20	PDB:4ytpD	0.349	0.523	2.749	102	0.089	0.147	4ytpD.pdb.gz	Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99643	1.22e-122	344	169	1.000	1.000	C560_HUMAN Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHC PE=1 SV=1
2	D0VWV4	3.16e-113	320	169	0.917	0.917	C560_PIG Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Sus scrofa OX=9823 GN=SDHC PE=1 SV=2
3	P35720	7.46e-110	311	169	0.899	0.899	C560_BOVIN Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Bos taurus OX=9913 GN=SDHC PE=1 SV=2
4	Q9CZB0	1.38e-91	265	169	0.799	0.799	C560_MOUSE Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Mus musculus OX=10090 GN=Sdhc PE=1 SV=1
5	Q8MYW1	1.05e-27	103	171	0.361	0.357	Q8MYW1_DROME RH04289p OS=Drosophila melanogaster OX=7227 GN=SdhC PE=2 SV=1
6	Q9VGS3	1.69e-27	103	171	0.349	0.345	Q9VGS3_DROME RH44771p OS=Drosophila melanogaster OX=7227 GN=SdhC PE=1 SV=2
7	Q8T2T5	1.01e-23	94.0	192	0.308	0.271	C560_DICDI Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=sdhC PE=3 SV=1
8	P41956	1.06e-19	83.2	182	0.290	0.269	C560_CAEEL Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=mev-1 PE=2 SV=1
9	O74882	5.23e-19	81.3	180	0.355	0.333	SDH3_SCHPO Succinate dehydrogenase cytochrome B subunit, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sdh3 PE=3 SV=1
10	Q2U3V9	2.12e-16	74.7	188	0.290	0.261	Q2U3V9_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090020000596 PE=4 SV=1
11	Q5ALU6	3.61e-16	73.9	176	0.284	0.273	Q5ALU6_CANAL Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C201690WA PE=4 SV=1
12	Q04487	3.13e-07	50.1	196	0.207	0.179	SHH3_YEAST Mitochondrial inner membrane protein SHH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SHH3 PE=3 SV=1
13	P33421	1.28e-05	45.8	198	0.249	0.212	SDH3_YEAST Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SDH3 PE=1 SV=1
14	P69054	0.003	38.1	129	0.160	0.209	DHSC_ECOLI Succinate dehydrogenase cytochrome b556 subunit OS=Escherichia coli (strain K12) OX=83333 GN=sdhC PE=1 SV=1
15	P0DKI0	0.16	33.9	213	0.178	0.141	SDH31_ARATH Succinate dehydrogenase subunit 3-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SDH3-1 PE=1 SV=1
16	P0DKI1	0.16	33.9	213	0.178	0.141	SDH32_ARATH Succinate dehydrogenase subunit 3-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SDH3-2 PE=1 SV=1
17	Q6ZH92	0.24	32.7	129	0.095	0.124	SDH31_ORYSJ Succinate dehydrogenase subunit 3-1, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=SDH3-1 PE=1 SV=1
18	Q84VK7	0.63	31.6	129	0.095	0.124	SDH32_ORYSJ Succinate dehydrogenase subunit 3-2, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=SDH3-2 PE=1 SV=2
19	Q92413	1.8	31.2	454	0.166	0.062	OAT_EMENI Ornithine aminotransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=otaA PE=1 SV=2
20	P31352	4.3	30.0	2331	0.107	0.008	L_MABVM RNA-directed RNA polymerase L OS=Lake Victoria marburgvirus (strain Musoke-80) OX=33727 GN=L PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01127 Sdh_cyt	4.6e-23	93.0	Succinate dehydrogenase/Fumarate reductase transmembrane subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356953

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264932	0.999	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
2	9606.ENSP00000364649	0.999	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
3	9606.ENSP00000364699	0.999	Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
4	9606.ENSP00000377446	0.991	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
5	9606.ENSP00000355518	0.989	Fumarate hydratase, mitochondrial
6	9606.ENSP00000367923	0.968	Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
7	9606.ENSP00000356972	0.956	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
8	9606.ENSP00000419325	0.956	Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial
9	9606.ENSP00000263774	0.952	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
10	9606.ENSP00000215375	0.951	ATP synthase subunit delta, mitochondrial
11	9606.ENSP00000349142	0.950	ATP synthase subunit gamma, mitochondrial
12	9606.ENSP00000306397	0.948	Cytochrome b-c1 complex subunit Rieske, mitochondrial
13	9606.ENSP00000258424	0.944	Cytochrome c oxidase subunit 5B, mitochondrial
14	9606.ENSP00000292475	0.944	ATP synthase subunit f, mitochondrial
15	9606.ENSP00000268668	0.933	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
16	9606.ENSP00000362873	0.924	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
17	9606.ENSP00000215565	0.923	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
18	9606.ENSP00000367939	0.922	Cytochrome b-c1 complex subunit 8
19	9606.ENSP00000299166	0.920	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
20	9606.ENSP00000315774	0.920	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.995	organic cyclic compound binding
GO:1901363	0.994	heterocyclic compound binding
GO:0020037	0.976	heme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0008152	0.995	metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0044238	0.989	primary metabolic process
GO:0045333	0.979	cellular respiration
GO:0009060	0.971	aerobic respiration
GO:0006099	0.937	tricarboxylic acid cycle
GO:0050896	0.395	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005743	0.997	mitochondrial inner membrane
GO:0098796	0.992	membrane protein complex
GO:1990204	0.987	oxidoreductase complex
GO:0070469	0.976	respirasome
GO:0098803	0.972	respiratory chain complex
GO:0005746	0.918	mitochondrial respirasome
GO:0098798	0.904	mitochondrial protein-containing complex
GO:0098800	0.870	inner mitochondrial membrane protein complex
GO:0045281	0.850	succinate dehydrogenase complex
GO:0045257	0.839	succinate dehydrogenase complex (ubiquinone)
GO:0045283	0.682	fumarate reductase complex
GO:0070013	0.526	intracellular organelle lumen
GO:0005634	0.478	nucleus
GO:0005749	0.419	mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone)

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]