StarFunc result for job id Q99650

User Input

>input (979 residues)
MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYH
QELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDD
AKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCY
LEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEP
KDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQ
DSQETYNFTLIAENYLRKRSVNILFNLTHRVYLMNPFSVNFENVNATNAIMTWKVHSIRN
NFTYLCQIELHGEGKMMQYNVSIKVNGEYFLSELEPATEYMARVRCADASHFWKWSEWSG
QNFTTLEAAPSEAPDVWRIVSLEPGNHTVTLFWKPLSKLHANGKILFYNVVVENLDKPSS
SELHSIPAPANSTKLILDRCSYQICVIANNSVGASPASVIVISADPENKEVEEERIAGTE
GGFSLSWKPQPGDVIGYVVDWCDHTQDVLGDFQWKNVGPNTTSTVISTDAFRPGVRYDFR
IYGLSTKRIACLLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQGY
HVYLKSKARQCHPRFEKAVLSDGSECCKYKIDNPEEKALIVDNLKPESFYEFFITPFTSA
GEGPSATFTKVTTPDEHSSMLIHILLPMVFCVLLIMVMCYLKSQWIKETCYPDIPDPYKS
SILSLIKFKENPHLIIMNVSDCIPDAIEVVSKPEGTKIQFLGTRKSLTETELTKPNYLYL
LPTEKNHSGPGPCICFENLTYNQAASDSGSCGHVPVSPKAPSMLGLMTSPENVLKALEKN
YMNSLGEIPAGETSLNYVSQLASPMFGDKDSLPTNPVEAPHCSEYKMQMAVSLRLALPPP
TENSSLSSITLLDPGEHYC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O70458	0.650	0.655	0.000	971	0.549	0.553	O70458.pdb.gz	OSMR_MOUSE Oncostatin-M-specific receptor subunit beta OS=Mus musculus OX=10090 GN=Osmr PE=1 SV=1
2	AFDB:Q99650	1.000	1.000	0.000	979	1.000	1.000	Q99650.pdb.gz	OSMR_HUMAN Oncostatin-M-specific receptor subunit beta OS=Homo sapiens OX=9606 GN=OSMR PE=1 SV=1
3	AFDB:P42702	0.541	0.490	1.645E-68	1097	0.290	0.259	P42702.pdb.gz	LIFR_HUMAN Leukemia inhibitory factor receptor OS=Homo sapiens OX=9606 GN=LIFR PE=1 SV=1
4	AFDB:O70535	0.517	0.470	4.337E-68	1093	0.282	0.253	O70535.pdb.gz	LIFR_RAT Leukemia inhibitory factor receptor OS=Rattus norvegicus OX=10116 GN=Lifr PE=2 SV=1
5	AFDB:F1NDH9	0.286	0.252	4.298E-33	1148	0.144	0.123	F1NDH9.pdb.gz
6	AFDB:R9QT79	0.203	0.183	3.131E-32	1132	0.155	0.134	R9QT79.pdb.gz	R9QT79_ONCMY Long-form leptin receptor OS=Oncorhynchus mykiss OX=8022 GN=LepR PE=2 SV=1
7	AFDB:Q9W213	0.142	0.106	7.625E-30	1395	0.150	0.105	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
8	AFDB:Q4KMG0	0.143	0.115	8.087E-28	1287	0.148	0.113	Q4KMG0.pdb.gz	CDON_HUMAN Cell adhesion molecule-related/down-regulated by oncogenes OS=Homo sapiens OX=9606 GN=CDON PE=1 SV=2
9	AFDB:A0A2R8QRK0	0.145	0.108	8.242E-25	1420	0.144	0.099	A0A2R8QRK0.pdb.gz	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
10	AFDB:Q7KSE9	0.202	0.111	1.502E-24	2087	0.132	0.062	Q7KSE9.pdb.gz	Q7KSE9_DROME Down syndrome cell adhesion molecule 3, isoform E OS=Drosophila melanogaster OX=7227 GN=Dscam3 PE=4 SV=2
11	PDB:7q5zA	0.106	0.085	8.466E-16	1344	0.083	0.060	7q5zA.pdb.gz
12	PDB:7q1yA	0.095	0.077	1.692E-15	1374	0.087	0.062	7q1yA.pdb.gz
13	PDB:5oj2B	0.103	0.132	1.492E-13	692	0.105	0.149	5oj2B.pdb.gz
14	PDB:7vonA	0.094	0.078	3.272E-13	1399	0.097	0.068	7vonA.pdb.gz
15	PDB:1e07A	0.148	0.211	6.245E-13	642	0.092	0.140	1e07A.pdb.gz
16	PDB:4lnvA	0.100	0.085	8.629E-13	1276	0.079	0.060	4lnvA.pdb.gz
17	PDB:5a42A	0.096	0.065	2.614E-12	1597	0.091	0.056	5a42A.pdb.gz
18	PDB:6h03A	0.105	0.091	3.782E-12	1223	0.084	0.067	6h03A.pdb.gz
19	PDB:7sqcO0	0.122	0.109	1.658E-11	1140	0.068	0.059	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
20	PDB:7nycA	0.105	0.077	4.371E-11	1542	0.076	0.048	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O70458	0.0	1031	971	0.550	0.554	OSMR_MOUSE Oncostatin-M-specific receptor subunit beta OS=Mus musculus OX=10090 GN=Osmr PE=1 SV=1
2	Q99650	0.0	2036	979	1.000	1.000	OSMR_HUMAN Oncostatin-M-specific receptor subunit beta OS=Homo sapiens OX=9606 GN=OSMR PE=1 SV=1
3	P42702	4.01e-120	395	1097	0.276	0.246	LIFR_HUMAN Leukemia inhibitory factor receptor OS=Homo sapiens OX=9606 GN=LIFR PE=1 SV=1
4	O70535	2.14e-107	360	1093	0.281	0.252	LIFR_RAT Leukemia inhibitory factor receptor OS=Rattus norvegicus OX=10116 GN=Lifr PE=2 SV=1
5	P42703	1.77e-101	344	1092	0.282	0.253	LIFR_MOUSE Leukemia inhibitory factor receptor OS=Mus musculus OX=10090 GN=Lifr PE=1 SV=1
6	Q00560	3.83e-32	137	917	0.162	0.173	IL6RB_MOUSE Interleukin-6 receptor subunit beta OS=Mus musculus OX=10090 GN=Il6st PE=1 SV=2
7	F1RCZ2	1.73e-29	129	859	0.180	0.205	F1RCZ2_DANRE Interleukin 6 cytokine family signal transduce OS=Danio rerio OX=7955 GN=gp130 PE=4 SV=2
8	Q99665	2.12e-29	128	862	0.161	0.183	I12R2_HUMAN Interleukin-12 receptor subunit beta-2 OS=Homo sapiens OX=9606 GN=IL12RB2 PE=1 SV=1
9	Q17RA0	1.62e-28	125	918	0.146	0.156	Q17RA0_HUMAN Interleukin 6 signal transducer (Gp130, oncostatin M receptor) OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=1
10	P40189	1.86e-28	125	918	0.146	0.156	IL6RB_HUMAN Interleukin-6 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=2
11	P40190	2.29e-28	125	918	0.163	0.174	IL6RB_RAT Interleukin-6 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Il6st PE=1 SV=1
12	P97378	1.27e-25	116	874	0.159	0.178	I12R2_MOUSE Interleukin-12 receptor subunit beta-2 OS=Mus musculus OX=10090 GN=Il12rb2 PE=1 SV=1
13	F1LRH7	4.87e-24	111	869	0.152	0.171	F1LRH7_RAT Interleukin 12 receptor subunit beta 2 OS=Rattus norvegicus OX=10116 GN=Il12rb2 PE=3 SV=2
14	F1R904	4.47e-18	92.0	810	0.099	0.120	F1R904_DANRE Colony-stimulating factor 3 receptor (granulocyte) OS=Danio rerio OX=7955 GN=gcsfr PE=3 SV=1
15	A8Y5W0	6.20e-18	91.7	810	0.099	0.120	A8Y5W0_DANRE Granulocyte colony-stimulating factor receptor OS=Danio rerio OX=7955 GN=gcsfr PE=2 SV=1
16	Q8NI17	6.53e-18	91.3	732	0.137	0.183	IL31R_HUMAN Interleukin-31 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL31RA PE=1 SV=1
17	A8WH79	1.19e-17	90.9	866	0.172	0.194	A8WH79_DANRE Gp130 protein OS=Danio rerio OX=7955 GN=gp130 PE=2 SV=1
18	A0A0A0MTN7	2.31e-16	85.9	549	0.115	0.206	A0A0A0MTN7_HUMAN Interleukin 12 receptor subunit beta 2 OS=Homo sapiens OX=9606 GN=IL12RB2 PE=1 SV=2
19	Q99062	4.99e-13	75.9	836	0.102	0.120	CSF3R_HUMAN Granulocyte colony-stimulating factor receptor OS=Homo sapiens OX=9606 GN=CSF3R PE=1 SV=1
20	Q90374	7.90e-12	72.0	830	0.088	0.104	PRLR_COLLI Prolactin receptor OS=Columba livia OX=8932 GN=PRLR PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09067 EpoR_lig-bind	1.3e+02	14.2	Erythropoietin receptor, ligand binding
2	PF00041 fn3	7.9e-20	82.3	Fibronectin type III domain
3	PF17971 LIFR_D2	6.4e-19	79.6	Leukemia inhibitory factor receptor D2 domain
4	PF16656 Pur_ac_phosph_N	2.8e+02	13.6	Purple acid Phosphatase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000274276

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215781	0.997	Oncostatin-M
2	9606.ENSP00000366234	0.983	Interleukin-31
3	9606.ENSP00000343204	0.960	Tyrosine-protein kinase JAK1
4	9606.ENSP00000370698	0.956	Interleukin-6 receptor subunit beta
5	9606.ENSP00000371067	0.901	Tyrosine-protein kinase JAK2
6	9606.ENSP00000415900	0.888	Interleukin-31 receptor subunit alpha
7	9606.ENSP00000391676	0.846	Tyrosine-protein kinase JAK3
8	9606.ENSP00000279804	0.842	Cardiotrophin-1
9	9606.ENSP00000249075	0.828	Leukemia inhibitory factor
10	9606.ENSP00000264563	0.823	Interleukin-11
11	9606.ENSP00000385675	0.813	Interleukin-6
12	9606.ENSP00000401303	0.806	SHC-transforming protein 1
13	9606.ENSP00000355370	0.803	Ciliary neurotrophic factor
14	9606.ENSP00000225474	0.794	Granulocyte colony-stimulating factor
15	9606.ENSP00000431885	0.791	Non-receptor tyrosine-protein kinase TYK2
16	9606.ENSP00000263409	0.707	Leukemia inhibitory factor receptor
17	9606.ENSP00000265171	0.698	Pro-epidermal growth factor
18	9606.ENSP00000269571	0.688	Receptor tyrosine-protein kinase erbB-2
19	9606.ENSP00000231449	0.685	Interleukin-4
20	9606.ENSP00000369578	0.677	Interferon omega 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004896	1.000	cytokine receptor activity
GO:0019838	0.992	growth factor binding
GO:0004924	0.586	oncostatin-M receptor activity
GO:0005102	0.379	signaling receptor binding
GO:0005126	0.369	cytokine receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.999	response to stimulus
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.996	cellular process
GO:0048583	0.989	regulation of response to stimulus
GO:0048518	0.986	positive regulation of biological process
GO:0042221	0.984	response to chemical
GO:0042127	0.982	regulation of cell population proliferation
GO:0051716	0.980	cellular response to stimulus
GO:0023052	0.979	signaling
GO:0007154	0.975	cell communication
GO:0007166	0.971	cell surface receptor signaling pathway
GO:0010033	0.968	response to organic substance
GO:0048522	0.962	positive regulation of cellular process
GO:0019221	0.956	cytokine-mediated signaling pathway
GO:0048584	0.947	positive regulation of response to stimulus
GO:0008284	0.934	positive regulation of cell population proliferation
GO:0032101	0.923	regulation of response to external stimulus
GO:0080134	0.921	regulation of response to stress
GO:0050727	0.909	regulation of inflammatory response
GO:0019222	0.557	regulation of metabolic process
GO:0009893	0.521	positive regulation of metabolic process
GO:0031323	0.478	regulation of cellular metabolic process
GO:0032103	0.452	positive regulation of response to external stimulus
GO:0031349	0.435	positive regulation of defense response
GO:0048856	0.412	anatomical structure development
GO:0060255	0.386	regulation of macromolecule metabolic process
GO:0050729	0.378	positive regulation of inflammatory response
GO:0010604	0.363	positive regulation of macromolecule metabolic process
GO:0080090	0.356	regulation of primary metabolic process
GO:0051171	0.356	regulation of nitrogen compound metabolic process
GO:0051239	0.354	regulation of multicellular organismal process
GO:0042325	0.341	regulation of phosphorylation
GO:0032501	0.330	multicellular organismal process
GO:0023051	0.328	regulation of signaling
GO:0010468	0.320	regulation of gene expression
GO:0002673	0.316	regulation of acute inflammatory response
GO:0031325	0.313	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.994	protein-containing complex
GO:0005576	0.933	extracellular region
GO:0043235	0.925	receptor complex
GO:0098797	0.660	plasma membrane protein complex
GO:0043226	0.641	organelle
GO:0043227	0.629	membrane-bounded organelle
GO:0098802	0.618	plasma membrane signaling receptor complex
GO:0031982	0.552	vesicle
GO:0098590	0.466	plasma membrane region
GO:0005900	0.390	oncostatin-M receptor complex
GO:0045177	0.373	apical part of cell
GO:0016324	0.360	apical plasma membrane
GO:0005615	0.324	extracellular space
GO:0005622	0.313	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]