StarFunc result for job id Q99653

User Input

>input (195 residues)
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFR
LYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
EKVDVEQKMSIRFLH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P61022	0.981	0.981	2.949E-30	195	0.990	0.990	P61022.pdb.gz	CHP1_MOUSE Calcineurin B homologous protein 1 OS=Mus musculus OX=10090 GN=Chp1 PE=1 SV=2
2	PDB:2ct9B	0.866	0.853	3.727E-25	198	0.949	0.934	2ct9B.pdb.gz	Structural characterization of calcineurin B homologous protein 1
3	AFDB:O43745	0.932	0.928	1.525E-23	196	0.610	0.607	O43745.pdb.gz	CHP2_HUMAN Calcineurin B homologous protein 2 OS=Homo sapiens OX=9606 GN=CHP2 PE=1 SV=3
4	AFDB:Q810D1	0.946	0.941	2.980E-23	196	0.615	0.612	Q810D1.pdb.gz	CHP2_RAT Calcineurin B homologous protein 2 OS=Rattus norvegicus OX=10116 GN=Chp2 PE=1 SV=1
5	PDB:2becA	0.884	0.951	7.010E-21	181	0.590	0.635	2becA.pdb.gz	Crystal structure of CHP2 complexed with NHE1-cytosolic region and an implication for pH regulation
6	AFDB:Q7K107	0.897	0.754	3.294E-20	233	0.595	0.498	Q7K107.pdb.gz	Q7K107_DROME LD19356p (Fragment) OS=Drosophila melanogaster OX=7227 GN=elm PE=2 SV=1
7	AFDB:Q55G87	0.823	0.887	7.613E-16	180	0.390	0.422	Q55G87.pdb.gz	CANB1_DICDI Calcineurin subunit B type 1 OS=Dictyostelium discoideum OX=44689 GN=cnbA PE=1 SV=1
8	AFDB:J9VL81	0.789	0.874	1.150E-15	175	0.364	0.406	J9VL81.pdb.gz	J9VL81_CRYNH Calcineurin subunit B OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_00888 PE=1 SV=1
9	PDB:6tz8B	0.776	0.862	5.671E-15	174	0.344	0.385	6tz8B.pdb.gz	Harnessing calcineurin-FK506-FKBP12 crystal structures from invasive fungal pathogens to develop antifungal agents.
10	AFDB:Q9UU93	0.793	0.884	2.665E-14	174	0.338	0.379	Q9UU93.pdb.gz	CANB_SCHPO Calcineurin subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cnb1 PE=3 SV=1
11	AFDB:P63098	0.748	0.849	3.110E-14	170	0.400	0.459	P63098.pdb.gz	CANB1_HUMAN Calcineurin subunit B type 1 OS=Homo sapiens OX=9606 GN=PPP3R1 PE=1 SV=2
12	AFDB:P48451	0.751	0.852	5.482E-14	170	0.379	0.435	P48451.pdb.gz	CANB1_DROME Calcineurin subunit B type 1 OS=Drosophila melanogaster OX=7227 GN=CanB PE=2 SV=1
13	AFDB:G5EDN6	0.765	0.866	1.188E-13	171	0.385	0.439	G5EDN6.pdb.gz	CANB_CAEEL Protein phosphatase 2B regulatory subunit cnb-1 OS=Caenorhabditis elegans OX=6239 GN=cnb-1 PE=1 SV=1
14	PDB:7u0tA	0.722	0.739	1.642E-12	190	0.379	0.389	7u0tA.pdb.gz	Structure-Guided Synthesis of FK506 and FK520 Analogs with Increased Selectivity Exhibit In Vivo Therapeutic Efficacy against Cryptococcus.
15	PDB:4il1A	0.662	0.255	2.230E-9	529	0.359	0.132	4il1A.pdb.gz	Structural basis of calcineurin activation by calmodulin.
16	PDB:2zfdA	0.693	0.734	3.931E-9	183	0.256	0.273	2zfdA.pdb.gz	The crystal structure of plant-specific calcium-binding protein AtCBL2 in complex with the regulatory domain of AtCIPK14
17	PDB:6wu5B	0.711	0.753	1.102E-8	183	0.231	0.246	6wu5B.pdb.gz	CIB2 and CIB3 are auxiliary subunits of the mechanotransduction channel of hair cells.
18	PDB:1v1fA	0.718	0.743	3.604E-8	188	0.226	0.234	1v1fA.pdb.gz	The Structure of the Arabidopsis Thaliana SOS3: Molecular Mechanism of Sensing Calcium for Salt Stress Response
19	PDB:5aanA	0.685	0.725	6.033E-8	183	0.210	0.224	5aanA.pdb.gz	Interference of the complex between NCS-1 and Ric8a with phenothiazines regulates synaptic function and is an approach for fragile X syndrome.
20	PDB:7ukhI	0.671	0.717	6.352E-8	181	0.200	0.215	7ukhI.pdb.gz	Activation and closed-state inactivation mechanisms of the human voltage-gated K V 4 channel complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99653	5.58e-142	395	195	1.000	1.000	CHP1_HUMAN Calcineurin B homologous protein 1 OS=Homo sapiens OX=9606 GN=CHP1 PE=1 SV=3
2	P61022	2.93e-140	390	195	0.990	0.990	CHP1_MOUSE Calcineurin B homologous protein 1 OS=Mus musculus OX=10090 GN=Chp1 PE=1 SV=2
3	P61023	2.93e-140	390	195	0.990	0.990	CHP1_RAT Calcineurin B homologous protein 1 OS=Rattus norvegicus OX=10116 GN=Chp1 PE=1 SV=2
4	Q5ZM44	1.40e-137	384	195	0.969	0.969	CHP1_CHICK Calcineurin B homologous protein 1 OS=Gallus gallus OX=9031 GN=CHP1 PE=1 SV=3
5	O43745	3.12e-83	246	196	0.610	0.607	CHP2_HUMAN Calcineurin B homologous protein 2 OS=Homo sapiens OX=9606 GN=CHP2 PE=1 SV=3
6	Q810D1	1.56e-82	244	196	0.615	0.612	CHP2_RAT Calcineurin B homologous protein 2 OS=Rattus norvegicus OX=10116 GN=Chp2 PE=1 SV=1
7	Q9VNF9	1.27e-78	234	189	0.610	0.630	Q9VNF9_DROME Ethanol sensitive with low memory, isoform A OS=Drosophila melanogaster OX=7227 GN=elm PE=1 SV=1
8	Q7K107	1.47e-78	236	233	0.610	0.511	Q7K107_DROME LD19356p (Fragment) OS=Drosophila melanogaster OX=7227 GN=elm PE=2 SV=1
9	Q55G87	3.68e-39	134	180	0.390	0.422	CANB1_DICDI Calcineurin subunit B type 1 OS=Dictyostelium discoideum OX=44689 GN=cnbA PE=1 SV=1
10	P63098	2.07e-38	132	170	0.374	0.429	CANB1_HUMAN Calcineurin subunit B type 1 OS=Homo sapiens OX=9606 GN=PPP3R1 PE=1 SV=2
11	P63099	2.07e-38	132	170	0.374	0.429	CANB1_BOVIN Calcineurin subunit B type 1 OS=Bos taurus OX=9913 GN=PPP3R1 PE=1 SV=2
12	P63100	2.07e-38	132	170	0.374	0.429	CANB1_RAT Calcineurin subunit B type 1 OS=Rattus norvegicus OX=10116 GN=Ppp3r1 PE=1 SV=2
13	Q63810	2.07e-38	132	170	0.374	0.429	CANB1_MOUSE Calcineurin subunit B type 1 OS=Mus musculus OX=10090 GN=Ppp3r1 PE=1 SV=3
14	H9G2Y1	1.30e-36	127	170	0.359	0.412	H9G2Y1_CAEEL EF-hand domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cnb-1 PE=1 SV=1
15	J9VL81	1.72e-36	127	175	0.364	0.406	J9VL81_CRYNH Calcineurin subunit B OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_00888 PE=1 SV=1
16	G5EDN6	2.18e-36	126	171	0.369	0.421	CANB_CAEEL Protein phosphatase 2B regulatory subunit cnb-1 OS=Caenorhabditis elegans OX=6239 GN=cnb-1 PE=1 SV=1
17	Q4QC21	5.92e-36	125	175	0.349	0.389	Q4QC21_LEIMA Putative calcineurin B subunit OS=Leishmania major OX=5664 GN=LMJF_21_1630 PE=3 SV=1
18	Q24214	7.36e-35	122	170	0.354	0.406	CANB2_DROME Calcineurin subunit B type 2 OS=Drosophila melanogaster OX=7227 GN=CanB2 PE=1 SV=2
19	P48451	1.24e-34	122	170	0.359	0.412	CANB1_DROME Calcineurin subunit B type 1 OS=Drosophila melanogaster OX=7227 GN=CanB PE=2 SV=1
20	Q38CK1	2.82e-34	121	179	0.338	0.369	Q38CK1_TRYB2 Calcineurin B subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7970 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	9.4e-13	57.8	EF hand
2	PF12763 EF-hand_4	4.7e+02	12.2	Cytoskeletal-regulatory complex EF hand
3	PF13202 EF-hand_5	0.00027	31.5	EF hand
4	PF13405 EF-hand_6	1.4e-12	57.4	EF-hand domain
5	PF13499 EF-hand_7	3.3e-14	64.4	EF-hand domain pair
6	PF13833 EF-hand_8	0.00045	31.3	EF-hand domain pair
7	PF12174 RST	3.1	19.1	RCD1-SRO-TAF4 (RST) plant domain
8	PF10591 SPARC_Ca_bdg	0.3	22.8	Secreted protein acidic and rich in cysteine Ca binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000004214

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000011539	0.991	Sodium/hydrogen exchanger
2	61853.ENSNLEP00000013194	0.797	Sodium/hydrogen exchanger
3	61853.ENSNLEP00000005420	0.744	Sodium/hydrogen exchanger
4	61853.ENSNLEP00000017871	0.744	Sodium/hydrogen exchanger
5	61853.ENSNLEP00000017882	0.744	Sodium/hydrogen exchanger
6	61853.ENSNLEP00000006083	0.734	Sodium/hydrogen exchanger
7	61853.ENSNLEP00000018908	0.731	Protein phosphatase 3, catalytic subunit, gamma isozyme
8	61853.ENSNLEP00000020260	0.731	Protein phosphatase 3, catalytic subunit, beta isozyme
9	61853.ENSNLEP00000024305	0.731	Protein phosphatase 3, catalytic subunit, alpha isozyme
10	61853.ENSNLEP00000010057	0.677	Reticulocalbin 2, EF-hand calcium binding domain
11	61853.ENSNLEP00000008297	0.633	Serine/threonine kinase 17b
12	61853.ENSNLEP00000007906	0.602	Stabilin 2
13	61853.ENSNLEP00000003870	0.599	Uncharacterized protein
14	61853.ENSNLEP00000002579	0.597	Protein phosphatase 4, catalytic subunit
15	61853.ENSNLEP00000021041	0.591	Protein phosphatase 6, catalytic subunit
16	61853.ENSNLEP00000017887	0.588	Plastin 3
17	61853.ENSNLEP00000000938	0.574	Peptidylprolyl isomerase
18	61853.ENSNLEP00000005359	0.574	Peptidylprolyl isomerase
19	61853.ENSNLEP00000011403	0.574	Peptidylprolyl isomerase
20	61853.ENSNLEP00000002498	0.559	Glyceronephosphate O-acyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0098772	0.996	molecular function regulator activity
GO:0005509	0.995	calcium ion binding
GO:0008092	0.727	cytoskeletal protein binding
GO:0030234	0.406	enzyme regulator activity
GO:0019900	0.309	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0048518	0.984	positive regulation of biological process
GO:0032879	0.982	regulation of localization
GO:0019222	0.975	regulation of metabolic process
GO:0050896	0.947	response to stimulus
GO:0060341	0.947	regulation of cellular localization
GO:0051174	0.936	regulation of phosphorus metabolic process
GO:0032880	0.935	regulation of protein localization
GO:0034762	0.921	regulation of transmembrane transport
GO:0080090	0.919	regulation of primary metabolic process
GO:0010959	0.909	regulation of metal ion transport
GO:0051179	0.903	localization
GO:0048519	0.900	negative regulation of biological process
GO:1904062	0.898	regulation of monoatomic cation transmembrane transport
GO:0048522	0.895	positive regulation of cellular process
GO:0019220	0.874	regulation of phosphate metabolic process
GO:0032412	0.872	regulation of monoatomic ion transmembrane transporter activity
GO:1902307	0.839	positive regulation of sodium ion transmembrane transport
GO:1903829	0.827	positive regulation of protein localization
GO:0060255	0.818	regulation of macromolecule metabolic process
GO:0035303	0.814	regulation of dephosphorylation
GO:0051171	0.812	regulation of nitrogen compound metabolic process
GO:2000649	0.810	regulation of sodium ion transmembrane transporter activity
GO:0032414	0.805	positive regulation of ion transmembrane transporter activity
GO:0009893	0.795	positive regulation of metabolic process
GO:0044092	0.775	negative regulation of molecular function
GO:0032386	0.763	regulation of intracellular transport
GO:2000651	0.761	positive regulation of sodium ion transmembrane transporter activity
GO:0051234	0.751	establishment of localization
GO:0010155	0.739	regulation of proton transport
GO:0065008	0.729	regulation of biological quality
GO:0006810	0.725	transport
GO:0048523	0.706	negative regulation of cellular process
GO:0033157	0.699	regulation of intracellular protein transport
GO:0045936	0.692	negative regulation of phosphate metabolic process
GO:0046822	0.676	regulation of nucleocytoplasmic transport
GO:0050790	0.657	regulation of catalytic activity
GO:0031647	0.656	regulation of protein stability
GO:0051716	0.654	cellular response to stimulus
GO:0031399	0.654	regulation of protein modification process
GO:1905475	0.650	regulation of protein localization to membrane
GO:0050848	0.643	regulation of calcium-mediated signaling
GO:0007154	0.637	cell communication
GO:0032388	0.614	positive regulation of intracellular transport
GO:1903533	0.610	regulation of protein targeting
GO:0019219	0.589	regulation of nucleobase-containing compound metabolic process
GO:1905477	0.586	positive regulation of protein localization to membrane
GO:0031325	0.584	positive regulation of cellular metabolic process
GO:0051173	0.581	positive regulation of nitrogen compound metabolic process
GO:0031326	0.570	regulation of cellular biosynthetic process
GO:0010556	0.568	regulation of macromolecule biosynthetic process
GO:0090316	0.546	positive regulation of intracellular protein transport
GO:0050821	0.528	protein stabilization
GO:0023052	0.520	signaling
GO:0007165	0.514	signal transduction
GO:0032387	0.460	negative regulation of intracellular transport
GO:1903725	0.459	regulation of phospholipid metabolic process
GO:1900180	0.432	regulation of protein localization to nucleus
GO:0009891	0.428	positive regulation of biosynthetic process
GO:0045937	0.421	positive regulation of phosphate metabolic process
GO:0042325	0.387	regulation of phosphorylation
GO:0008152	0.376	metabolic process
GO:0006885	0.365	regulation of pH
GO:0071840	0.354	cellular component organization or biogenesis
GO:0071704	0.345	organic substance metabolic process
GO:0055082	0.335	intracellular chemical homeostasis
GO:0043086	0.334	negative regulation of catalytic activity
GO:0006873	0.326	intracellular monoatomic ion homeostasis
GO:0009628	0.319	response to abiotic stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0071944	0.991	cell periphery
GO:0005886	0.979	plasma membrane
GO:0043226	0.977	organelle
GO:0043227	0.973	membrane-bounded organelle
GO:0043231	0.960	intracellular membrane-bounded organelle
GO:0005737	0.941	cytoplasm
GO:0031982	0.929	vesicle
GO:0005576	0.912	extracellular region
GO:0005829	0.812	cytosol
GO:0005634	0.757	nucleus
GO:0012505	0.724	endomembrane system
GO:0070062	0.689	extracellular exosome
GO:0031090	0.623	organelle membrane
GO:0098588	0.460	bounding membrane of organelle
GO:0070013	0.377	intracellular organelle lumen
GO:0031981	0.351	nuclear lumen
GO:0032991	0.339	protein-containing complex
GO:0005654	0.325	nucleoplasm
GO:0030054	0.308	cell junction
GO:0031410	0.307	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]