StarFunc result for job id Q99665

User Input

>input (862 residues)
MAHTFRGCSLAFMFIITWLLIKAKIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCF
HYSRRNKLILYKFDRRINFHHGHSLNSQVTGLPLGTTLFVCKLACINSDEIQICGAEIFV
GVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDY
LDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVS
RCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKLHL
YKGSWSDWSESLRAQTPEEEPTGMLDVWYMKRHIDYSRQQISLFWKNLSVSEARGKILHY
QVTLQELTGGKAMTQNITGHTSWTTVIPRTGNWAVAVSAANSKGSSLPTRINIMNLCEAG
LLAPRQVSANSEGMDNILVTWQPPRKDPSAVQEYVVEWRELHPGGDTQVPLNWLRSRPYN
VSALISENIKSYICYEIRVYALSGDQGGCSSILGNSKHKAPLSGPHINAITEEKGSILIS
WNSIPVQEQMGCLLHYRIYWKERDSNSQPQLCEIPYRVSQNSHPINSLQPRVTYVLWMTA
LTAAGESSHGNEREFCLQGKANWMAFVAPSICIAIIMVGIFSTHYFQQKVFVLLAALRPQ
WCSREIPDPANSTCAKKYPIAEEKTQLPLDRLLIDWPTPEDPEPLVISEVLHQVTPVFRH
PPCSNWPQREKGIQGHQASEKDMMHSASSPPPPRALQAESRQLVDLYKVLESRGSDPKPE
NPACPWTVLPAGDLPTHDGYLPSNIDDLPSHEAPLADSLEELEPQHISLSVFPSSSLHPL
TFSCGDKLTLDQLKMRCDSLML

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99665	1.000	1.000	0.000	862	1.000	1.000	Q99665.pdb.gz	I12R2_HUMAN Interleukin-12 receptor subunit beta-2 OS=Homo sapiens OX=9606 GN=IL12RB2 PE=1 SV=1
2	AFDB:Q00560	0.542	0.514	1.561E-50	917	0.220	0.207	Q00560.pdb.gz	IL6RB_MOUSE Interleukin-6 receptor subunit beta OS=Mus musculus OX=10090 GN=Il6st PE=1 SV=2
3	AFDB:P40189	0.528	0.500	6.606E-50	918	0.225	0.211	P40189.pdb.gz	IL6RB_HUMAN Interleukin-6 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=2
4	AFDB:P40190	0.549	0.520	1.599E-49	918	0.223	0.209	P40190.pdb.gz	IL6RB_RAT Interleukin-6 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Il6st PE=1 SV=1
5	AFDB:Q99062	0.385	0.394	2.222E-43	836	0.216	0.222	Q99062.pdb.gz	CSF3R_HUMAN Granulocyte colony-stimulating factor receptor OS=Homo sapiens OX=9606 GN=CSF3R PE=1 SV=1
6	AFDB:O70535	0.437	0.356	3.712E-41	1093	0.210	0.166	O70535.pdb.gz	LIFR_RAT Leukemia inhibitory factor receptor OS=Rattus norvegicus OX=10116 GN=Lifr PE=2 SV=1
7	AFDB:Q99650	0.517	0.463	2.030E-39	979	0.203	0.179	Q99650.pdb.gz	OSMR_HUMAN Oncostatin-M-specific receptor subunit beta OS=Homo sapiens OX=9606 GN=OSMR PE=1 SV=1
8	AFDB:P43146	0.133	0.101	8.225E-33	1447	0.153	0.091	P43146.pdb.gz	DCC_HUMAN Netrin receptor DCC OS=Homo sapiens OX=9606 GN=DCC PE=1 SV=2
9	AFDB:F1QUB9	0.272	0.234	7.017E-26	1065	0.150	0.121	F1QUB9.pdb.gz
10	AFDB:Q9W213	0.150	0.102	1.018E-25	1395	0.164	0.101	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
11	PDB:1e07A	0.146	0.182	5.728E-12	642	0.096	0.129	1e07A.pdb.gz
12	PDB:5oj2B	0.149	0.171	5.728E-12	692	0.100	0.124	5oj2B.pdb.gz
13	PDB:7q5zA	0.120	0.088	8.311E-12	1344	0.068	0.044	7q5zA.pdb.gz
14	PDB:5a42A	0.117	0.071	1.206E-11	1597	0.082	0.044	5a42A.pdb.gz
15	PDB:4ziqA	0.105	0.069	1.453E-11	1450	0.082	0.049	4ziqA.pdb.gz
16	PDB:8dtlA	0.122	0.137	1.833E-11	741	0.053	0.062	8dtlA.pdb.gz
17	PDB:7q1yA	0.102	0.075	2.012E-11	1374	0.073	0.046	7q1yA.pdb.gz
18	PDB:6pxvA	0.179	0.186	2.919E-11	823	0.066	0.069	6pxvA.pdb.gz
19	PDB:4lnvA	0.114	0.087	3.356E-11	1276	0.070	0.047	4lnvA.pdb.gz
20	PDB:8eyyA	0.174	0.192	5.345E-11	775	0.068	0.076	8eyyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MTN7	0.0	1017	549	0.565	0.887	A0A0A0MTN7_HUMAN Interleukin 12 receptor subunit beta 2 OS=Homo sapiens OX=9606 GN=IL12RB2 PE=1 SV=2
2	F1LRH7	0.0	1119	869	0.657	0.651	F1LRH7_RAT Interleukin 12 receptor subunit beta 2 OS=Rattus norvegicus OX=10116 GN=Il12rb2 PE=3 SV=2
3	P97378	0.0	1139	874	0.671	0.661	I12R2_MOUSE Interleukin-12 receptor subunit beta-2 OS=Mus musculus OX=10090 GN=Il12rb2 PE=1 SV=1
4	Q99665	0.0	1791	862	1.000	1.000	I12R2_HUMAN Interleukin-12 receptor subunit beta-2 OS=Homo sapiens OX=9606 GN=IL12RB2 PE=1 SV=1
5	Q00560	6.53e-45	177	917	0.213	0.201	IL6RB_MOUSE Interleukin-6 receptor subunit beta OS=Mus musculus OX=10090 GN=Il6st PE=1 SV=2
6	Q17RA0	2.59e-41	166	918	0.209	0.196	Q17RA0_HUMAN Interleukin 6 signal transducer (Gp130, oncostatin M receptor) OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=1
7	P40190	6.63e-41	164	918	0.208	0.195	IL6RB_RAT Interleukin-6 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Il6st PE=1 SV=1
8	P40189	2.66e-40	162	918	0.208	0.195	IL6RB_HUMAN Interleukin-6 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=2
9	Q99062	7.28e-35	145	836	0.195	0.201	CSF3R_HUMAN Granulocyte colony-stimulating factor receptor OS=Homo sapiens OX=9606 GN=CSF3R PE=1 SV=1
10	F1RCZ2	2.38e-32	137	859	0.174	0.175	F1RCZ2_DANRE Interleukin 6 cytokine family signal transduce OS=Danio rerio OX=7955 GN=gp130 PE=4 SV=2
11	P42703	3.97e-31	134	1092	0.187	0.147	LIFR_MOUSE Leukemia inhibitory factor receptor OS=Mus musculus OX=10090 GN=Lifr PE=1 SV=1
12	Q99650	2.12e-30	131	979	0.183	0.161	OSMR_HUMAN Oncostatin-M-specific receptor subunit beta OS=Homo sapiens OX=9606 GN=OSMR PE=1 SV=1
13	P40223	6.61e-29	126	837	0.210	0.216	CSF3R_MOUSE Granulocyte colony-stimulating factor receptor OS=Mus musculus OX=10090 GN=Csf3r PE=1 SV=2
14	O70535	7.42e-29	126	1093	0.187	0.147	LIFR_RAT Leukemia inhibitory factor receptor OS=Rattus norvegicus OX=10116 GN=Lifr PE=2 SV=1
15	A8WH79	3.29e-27	121	866	0.173	0.172	A8WH79_DANRE Gp130 protein OS=Danio rerio OX=7955 GN=gp130 PE=2 SV=1
16	P42702	3.86e-27	121	1097	0.174	0.137	LIFR_HUMAN Leukemia inhibitory factor receptor OS=Homo sapiens OX=9606 GN=LIFR PE=1 SV=1
17	D4A3R0	8.98e-27	119	849	0.209	0.212	D4A3R0_RAT Colony stimulating factor 3 receptor OS=Rattus norvegicus OX=10116 GN=Csf3r PE=3 SV=2
18	F1R904	1.85e-25	115	810	0.197	0.210	F1R904_DANRE Colony-stimulating factor 3 receptor (granulocyte) OS=Danio rerio OX=7955 GN=gcsfr PE=3 SV=1
19	O70394	2.46e-25	114	623	0.144	0.199	I27RA_MOUSE Interleukin-27 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il27ra PE=1 SV=2
20	A8Y5W0	1.28e-24	112	810	0.193	0.205	A8Y5W0_DANRE Granulocyte colony-stimulating factor receptor OS=Danio rerio OX=7955 GN=gcsfr PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09067 EpoR_lig-bind	4.3e+02	12.5	Erythropoietin receptor, ligand binding
2	PF00041 fn3	1e-21	88.3	Fibronectin type III domain
3	PF09240 IL6Ra-bind	0.29	23.0	Interleukin-6 receptor alpha chain, binding
4	PF06328 Lep_receptor_Ig	2.8e-09	48.1	Ig-like C2-type domain
5	PF16656 Pur_ac_phosph_N	40	16.3	Purple acid Phosphatase, N-terminal domain
6	PF01108 Tissue_fac	0.94	20.7	Tissue factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262345

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000470788	0.998	Interleukin-12 receptor subunit beta-1
2	9606.ENSP00000376134	0.990	Signal transducer and activator of transcription 4
3	9606.ENSP00000231228	0.957	Interleukin-12 subunit beta
4	9606.ENSP00000371067	0.948	Tyrosine-protein kinase JAK2
5	9606.ENSP00000303231	0.946	Interleukin-12 subunit alpha
6	9606.ENSP00000354394	0.944	Signal transducer and activator of transcription 1-alpha/beta
7	9606.ENSP00000231449	0.941	Interleukin-4
8	9606.ENSP00000264657	0.938	Signal transducer and activator of transcription 3
9	9606.ENSP00000431885	0.937	Non-receptor tyrosine-protein kinase TYK2
10	9606.ENSP00000263341	0.929	Interleukin-1 beta
11	9606.ENSP00000300134	0.929	Signal transducer and activator of transcription 6
12	9606.ENSP00000329418	0.929	Suppressor of cytokine signaling 1
13	9606.ENSP00000341208	0.927	Signal transducer and activator of transcription 5A
14	9606.ENSP00000337825	0.911	Tyrosine-protein kinase Lck
15	9606.ENSP00000221452	0.909	Transcription factor RelB
16	9606.ENSP00000358983	0.904	Nuclear factor NF-kappa-B p100 subunit
17	9606.ENSP00000327251	0.902	Nitric oxide synthase, inducible
18	9606.ENSP00000245222	0.900	Sphingosine kinase 2
19	9606.ENSP00000263379	0.856	Interleukin-27 receptor subunit alpha
20	9606.ENSP00000343204	0.852	Tyrosine-protein kinase JAK1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004896	1.000	cytokine receptor activity
GO:0005515	0.995	protein binding
GO:0019955	0.443	cytokine binding
GO:0005102	0.323	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0048522	0.991	positive regulation of cellular process
GO:0050896	0.988	response to stimulus
GO:0009987	0.984	cellular process
GO:0001817	0.974	regulation of cytokine production
GO:0010604	0.965	positive regulation of macromolecule metabolic process
GO:0001819	0.954	positive regulation of cytokine production
GO:0051716	0.945	cellular response to stimulus
GO:0023052	0.944	signaling
GO:0007154	0.943	cell communication
GO:0008284	0.937	positive regulation of cell population proliferation
GO:1903037	0.931	regulation of leukocyte cell-cell adhesion
GO:0007165	0.930	signal transduction
GO:0045785	0.927	positive regulation of cell adhesion
GO:0050863	0.925	regulation of T cell activation
GO:0002684	0.908	positive regulation of immune system process
GO:0048583	0.907	regulation of response to stimulus
GO:0048584	0.896	positive regulation of response to stimulus
GO:0007166	0.894	cell surface receptor signaling pathway
GO:0050870	0.886	positive regulation of T cell activation
GO:0023051	0.877	regulation of signaling
GO:0010646	0.877	regulation of cell communication
GO:0009966	0.868	regulation of signal transduction
GO:0042102	0.860	positive regulation of T cell proliferation
GO:0009967	0.852	positive regulation of signal transduction
GO:1904892	0.782	regulation of receptor signaling pathway via STAT
GO:0046425	0.677	regulation of receptor signaling pathway via JAK-STAT
GO:0046634	0.614	regulation of alpha-beta T cell activation
GO:1904894	0.564	positive regulation of receptor signaling pathway via STAT
GO:0031323	0.554	regulation of cellular metabolic process
GO:0046427	0.550	positive regulation of receptor signaling pathway via JAK-STAT
GO:0032649	0.543	regulation of type II interferon production
GO:0032729	0.532	positive regulation of type II interferon production
GO:0080090	0.482	regulation of primary metabolic process
GO:0051171	0.480	regulation of nitrogen compound metabolic process
GO:0032502	0.475	developmental process
GO:0048856	0.474	anatomical structure development
GO:0042221	0.457	response to chemical
GO:0032814	0.454	regulation of natural killer cell activation
GO:0034097	0.425	response to cytokine
GO:0051173	0.408	positive regulation of nitrogen compound metabolic process
GO:0031325	0.386	positive regulation of cellular metabolic process
GO:0009605	0.377	response to external stimulus
GO:0032816	0.376	positive regulation of natural killer cell activation
GO:0070887	0.356	cellular response to chemical stimulus
GO:0009607	0.346	response to biotic stimulus
GO:0044419	0.345	biological process involved in interspecies interaction between organisms
GO:0002376	0.344	immune system process
GO:0071345	0.331	cellular response to cytokine stimulus
GO:0051707	0.325	response to other organism
GO:0006950	0.321	response to stress
GO:0019221	0.320	cytokine-mediated signaling pathway
GO:0046635	0.317	positive regulation of alpha-beta T cell activation
GO:0051246	0.315	regulation of protein metabolic process
GO:0032501	0.313	multicellular organismal process
GO:0051247	0.311	positive regulation of protein metabolic process
GO:0031399	0.307	regulation of protein modification process
GO:0001934	0.302	positive regulation of protein phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.669	membrane-bounded organelle
GO:0005622	0.575	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]