StarFunc result for job id Q99666

User Input

>input (1765 residues)
MRRSKADVERYVASVLGLTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDP
KAHRFLGLLYELEENTEKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWVER
AAKLFPGSPAIYKLKEQLLDCEGEDGWNKLFDLIQSELYVRPDDVHVNIRLVELYRSTKR
LKDAVAHCHEAERNIALRSSLEWNSCVVQTLKEYLESLQCLESDKSDWQATNTDLLLAYA
NLMLLTLSTRDVQENRELLESFDSALQSAKSSLGGNDELSATFLEMKGHFYMYAGSLLLK
MGQHGNNVQWRALSELAALCYLIAFQVPRPKIKLREGKAGQNLLEMMACDRLSQSGHMLL
SLSRGKQDFLKEVVETFANKIGQSALYDALFSSQSPKDTSFLGSDDIGKIDVQEPELEDL
ARYDVGAIRAHNGSLQHLTWLGLQWNSLPALPGIRKWLKQLFHRLPHETSRLETNAPESI
CILDLEVFLLGVVYTSHLQLKEKCNSHHSSYQPLCLPFPVCKQLCTERQKSWWDAVCTLI
HRKAVPGNLAKLRLLVQHEINTLRAQEKHGLQPALLVHWAKYLQKTGSGLNSFYGQLEYI
GRSVHYWKKVLPLLKIIKKNSIPEPIDPLFKHFHSVDIQASEIVEYEEDAHITFAMLDAV
NGNIEDAVTAFESIKSVVSYWNLALIFHRKAEDIENDALSPEEQEECRNYLTKTRDYLIK
IIDDGDSNLSVVKKLPVPLESVKQMLNSVMQELEDYSEGGPLYKNGSLRNADSEIKHSTP
SPTKYSLSPSKSYKYSPETPPRWTEDRNSLLNMICQQVEAIKKEMQELKLNSSKSASRHR
WPTENYGPDSVPDGYQGSQTFHGAPLTVATTGPSVYYSQSPAYNSQYLLRPAANVTPTKG
SSNTEFKSTKEGFSIPVSADGFKFGISEPGNQEKKREKPLENDTGFQAQDISGRKKGRGV
IFGQTSSTFTFADVAKSTSGEGFQFGKKDLNFKGFSGAGEKLFSSRYGKMANKANTSGDF
EKDDDAYKTEDSDDIHFEPVVQMPEKVELVTGEEGEKVLYSQGVKLFRFDAEVRQWKERG
LGNLKILKNEVNGKLRMLMRREQVLKVCANHWITTTMNLKPLSGSDRAWMWSASDFSDGD
AKLERLAAKFKTPELAEEFKQKFEECQRLLLDIPLQTPHKLVDTGRAAKLIQRAEEMKSG
LKDFKTFLTNDQTKVTEEENKGSGTGAAGASDTTIKPNAENTGPTLEWDNYDLREDALDD
SVSSSSVHASPLASSPVRKNLFRFDESTTGSNFSFKSALSLSKSPAKLNQSGTSVGTDEE
SVVTQEEERDGQYFEPVVPLPDLVEVSSGEENEQVVFSHRAEIYRYDKDVGQWKERGIGD
IKILQNYDNKQVRIVMRRDQVLKLCANHRITPDMSLQNMKGTERVWVWTACDFADGERKV
EHLAVRFKLQDVADSFKKIFDEAKTAQEKDSLITPHVSRSSTPRESPCGKIAVAILEETT
RERTDVIQGDDVADAASEVEVSSTSETTTKAVVSPPKFVFVSESVKRIFSSEKSKPFVFG
NSSATGSLFGFSFNAPLKSNNSETSSVAQSGSESKVEPKKCELSKNSDIEQSSDSKVKNL
SASFPTEESSINYTFKTPEKEPPLWHAEFTKEELVQKLRSTTKSADHLNGLLREIEATNA
VLMEQIKLLKSEIRRLERNQEREKSAANLEYLKNVLLQFIFLKPGSERERLLPVINTMLQ
LSPEEKGKLAAVAQDEEENASRSSG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7r5j00	0.413	0.939	2.166E-81	756	0.408	0.952	7r5j00.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
2	AFDB:Q9LMK7	0.075	0.555	4.390E-12	228	0.041	0.320	Q9LMK7.pdb.gz	RBP1A_ARATH Ran-binding protein 1 homolog a OS=Arabidopsis thaliana OX=3702 GN=RANBP1A PE=1 SV=1
3	AFDB:Q8RWG8	0.078	0.582	6.687E-12	217	0.037	0.304	Q8RWG8.pdb.gz	RBP1B_ARATH Ran-binding protein 1 homolog b OS=Arabidopsis thaliana OX=3702 GN=RANBP1B PE=1 SV=2
4	AFDB:Q09717	0.083	0.598	3.600E-11	215	0.039	0.316	Q09717.pdb.gz	RANG_SCHPO Ran-specific GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sbp1 PE=1 SV=1
5	PDB:1k5dB	0.075	0.851	8.073E-11	146	0.039	0.473	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
6	AFDB:A0A1D8PRQ3	0.072	0.576	1.179E-10	212	0.043	0.358	A0A1D8PRQ3.pdb.gz	A0A1D8PRQ3_CANAL Ran GTPase-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YRB1 PE=4 SV=1
7	PDB:3m1iB	0.073	0.941	6.373E-10	131	0.031	0.420	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
8	AFDB:Q6PR54	0.075	0.063	1.853E-9	2419	0.133	0.097	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
9	PDB:7dkhI	0.082	0.141	1.041E-8	914	0.056	0.107	7dkhI.pdb.gz
10	AFDB:Q5UIP0	0.077	0.063	2.698E-8	2472	0.143	0.102	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
11	PDB:4bujB	0.101	0.124	8.537E-8	1367	0.054	0.069	4bujB.pdb.gz
12	AFDB:A1Z987	0.086	0.104	3.005E-7	1351	0.076	0.100	A1Z987.pdb.gz	A1Z987_DROME Chromosome associated protein G, isoform F OS=Drosophila melanogaster OX=7227 GN=Cap-G PE=1 SV=2
13	PDB:6tedQ	0.083	0.140	4.962E-7	890	0.060	0.119	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
14	AFDB:Q9VUH6	0.056	0.055	1.886E-6	1833	0.113	0.109	Q9VUH6.pdb.gz	Q9VUH6_DROME Myopic OS=Drosophila melanogaster OX=7227 GN=mop PE=1 SV=2
15	PDB:7qdrB	0.101	0.142	2.207E-6	1212	0.072	0.105	7qdrB.pdb.gz
16	AFDB:I3ITL5	0.054	0.047	5.298E-6	2041	0.085	0.073	I3ITL5.pdb.gz	I3ITL5_DANRE Myosin X,-like 1 OS=Danio rerio OX=7955 GN=myo10l1 PE=3 SV=1
17	PDB:6yj6A	0.089	0.173	5.320E-6	819	0.050	0.109	6yj6A.pdb.gz
18	PDB:6c95A	0.109	0.227	9.090E-6	773	0.043	0.098	6c95A.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
19	PDB:7ntfA	0.100	0.172	1.880E-5	918	0.032	0.061	7ntfA.pdb.gz
20	AFDB:O95996	0.082	0.070	4.691E-5	2303	0.113	0.086	O95996.pdb.gz	APCL_HUMAN Adenomatous polyposis coli protein 2 OS=Homo sapiens OX=9606 GN=APC2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5YC36	0.0	1269	3114	0.370	0.210	A0A8I5YC36_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=1
2	D4A054	0.0	1268	3061	0.370	0.213	D4A054_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=3
3	M0R3M4	0.0	1268	3089	0.370	0.211	M0R3M4_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=2
4	P49792	0.0	1420	3224	0.401	0.220	RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2
5	Q9ERU9	0.0	1291	3053	0.370	0.214	RBP2_MOUSE E3 SUMO-protein ligase RanBP2 OS=Mus musculus OX=10090 GN=Ranbp2 PE=1 SV=2
6	Q8IWJ2	5.77e-66	250	1684	0.073	0.076	GCC2_HUMAN GRIP and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GCC2 PE=1 SV=4
7	Q8CHG3	1.22e-58	226	1680	0.063	0.066	GCC2_MOUSE GRIP and coiled-coil domain-containing protein 2 OS=Mus musculus OX=10090 GN=Gcc2 PE=1 SV=3
8	P41920	5.76e-40	149	201	0.045	0.398	YRB1_YEAST Ran-specific GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YRB1 PE=1 SV=1
9	A0A140VK94	3.78e-37	141	201	0.042	0.368	A0A140VK94_HUMAN RAN binding protein 1, isoform CRA_g OS=Homo sapiens OX=9606 GN=RANBP1 PE=2 SV=1
10	P43487	3.78e-37	141	201	0.042	0.368	RANG_HUMAN Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1
11	P34022	3.90e-37	141	203	0.044	0.379	RANG_MOUSE Ran-specific GTPase-activating protein OS=Mus musculus OX=10090 GN=Ranbp1 PE=1 SV=2
12	A0A8I5ZTU5	5.14e-37	141	219	0.040	0.324	A0A8I5ZTU5_RAT RAN binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ranbp1 PE=1 SV=1
13	D4A2G9	1.12e-36	139	188	0.040	0.378	D4A2G9_RAT RAN binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ranbp1 PE=1 SV=2
14	F6WQW2	2.30e-36	142	278	0.044	0.277	F6WQW2_HUMAN RAN binding protein 1 OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1
15	A0A1D8PRQ3	4.05e-34	133	212	0.035	0.288	A0A1D8PRQ3_CANAL Ran GTPase-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YRB1 PE=4 SV=1
16	Q21021	2.86e-33	142	860	0.035	0.072	Q21021_CAEEL Nuclear Pore complex Protein OS=Caenorhabditis elegans OX=6239 GN=npp-9 PE=1 SV=2
17	C9JJ34	1.68e-31	124	163	0.037	0.399	C9JJ34_HUMAN RAN binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1
18	Q9LMK7	1.61e-30	123	228	0.035	0.268	RBP1A_ARATH Ran-binding protein 1 homolog a OS=Arabidopsis thaliana OX=3702 GN=RANBP1A PE=1 SV=1
19	A0A0B4K7J2	2.84e-30	134	2718	0.041	0.027	RBP2_DROME E3 SUMO-protein ligase RanBP2 OS=Drosophila melanogaster OX=7227 GN=Nup358 PE=1 SV=1
20	P92985	8.30e-30	120	219	0.037	0.301	RBP1C_ARATH Ran-binding protein 1 homolog c OS=Arabidopsis thaliana OX=3702 GN=RANBP1C PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01465 GRIP	3.6e-14	63.6	GRIP domain
2	PF16704 Rab_bind	1.1e-34	129.6	Rab binding domain
3	PF00638 Ran_BP1	2.9e-104	355.4	RanBP1 domain
4	PF00515 TPR_1	0.0062	27.5	Tetratricopeptide repeat
5	PF13414 TPR_11	62	14.7	TPR repeat
6	PF13424 TPR_12	55	15.5	Tetratricopeptide repeat
7	PF13428 TPR_14	0.49	22.3	Tetratricopeptide repeat
8	PF13432 TPR_16	3.6	19.6	Tetratricopeptide repeat
9	PF14559 TPR_19	13	17.6	Tetratricopeptide repeat
10	PF07719 TPR_2	0.018	26.2	Tetratricopeptide repeat
11	PF13174 TPR_6	1.1e+02	14.9	Tetratricopeptide repeat
12	PF13176 TPR_7	95	14.4	Tetratricopeptide repeat
13	PF13181 TPR_8	0.13	23.5	Tetratricopeptide repeat
14	PF13371 TPR_9	1.1e+02	14.3	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000330842

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000336712	0.796	Transportin-1
2	9606.ENSP00000381098	0.767	Glutamate receptor-interacting protein 1
3	9606.ENSP00000446215	0.745	GTP-binding nuclear protein Ran
4	9606.ENSP00000384863	0.709	Exportin-1
5	9606.ENSP00000307411	0.648	Protein AF-10
6	9606.ENSP00000248984	0.603	Uncharacterized protein C22orf24
7	9606.ENSP00000485370	0.591	Protein FAM25A
8	9606.ENSP00000401470	0.575	Ran GTPase-activating protein 1
9	9606.ENSP00000383931	0.572	Platelet glycoprotein V
10	9606.ENSP00000272462	0.561	MAL-like protein
11	9606.ENSP00000316032	0.541	Nuclear pore complex protein Nup98-Nup96
12	9606.ENSP00000484732	0.532	Cytosolic arginine sensor for mTORC1 subunit 2
13	9606.ENSP00000392371	0.527	Zinc finger and SCAN domain-containing protein 30
14	9606.ENSP00000290158	0.524	Importin subunit beta-1
15	9606.ENSP00000405165	0.517	LIM and senescent cell antigen-like-containing domain protein 3
16	9606.ENSP00000362937	0.507	Regulator of chromosome condensation
17	9606.ENSP00000310668	0.500	Nuclear pore complex protein Nup93

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005515	1.000	protein binding
GO:0019789	0.997	SUMO transferase activity
GO:0031267	0.994	small GTPase binding
GO:0061665	0.975	SUMO ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.960	cellular process
GO:0051179	0.861	localization
GO:0050789	0.848	regulation of biological process
GO:0050896	0.837	response to stimulus
GO:0051641	0.819	cellular localization
GO:0051234	0.744	establishment of localization
GO:0006810	0.734	transport
GO:0050794	0.731	regulation of cellular process
GO:0046907	0.714	intracellular transport
GO:0008152	0.702	metabolic process
GO:0071704	0.666	organic substance metabolic process
GO:0051169	0.640	nuclear transport
GO:0006913	0.634	nucleocytoplasmic transport
GO:0043170	0.600	macromolecule metabolic process
GO:1901698	0.537	response to nitrogen compound
GO:0010243	0.528	response to organonitrogen compound
GO:0033036	0.481	macromolecule localization
GO:0008104	0.449	protein localization
GO:0044238	0.433	primary metabolic process
GO:0071702	0.424	organic substance transport
GO:0071705	0.410	nitrogen compound transport
GO:0006807	0.409	nitrogen compound metabolic process
GO:0019222	0.372	regulation of metabolic process
GO:0045184	0.349	establishment of protein localization
GO:0006886	0.343	intracellular protein transport
GO:0048518	0.309	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005643	0.996	nuclear pore
GO:0031981	0.981	nuclear lumen
GO:0005829	0.964	cytosol
GO:0016020	0.908	membrane
GO:0005654	0.846	nucleoplasm
GO:1902494	0.378	catalytic complex
GO:0044614	0.377	nuclear pore cytoplasmic filaments
GO:0106068	0.370	SUMO ligase complex
GO:0042175	0.368	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005642	0.357	annulate lamellae
GO:0042405	0.355	nuclear inclusion body
GO:0048471	0.324	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.998	Transferases.

[back to server]