StarFunc result for job id Q99683

User Input

>input (1374 residues)
MSTEADEGITFSVPPFAPSGFCTIPEGGICRRGGAAAVGEGEEHQLPPPPPGSFWNVESA
AAPGIGCPAATSSSSATRGRGSSVGGGSRRTTVAYVINEASQGQLVVAESEALQSLREAC
ETVGATLETLHFGKLDFGETTVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFSMANN
IILYCDTNSDSLQSLKEIICQKNTMCTGNYTFVPYMITPHNKVYCCDSSFMKGLTELMQP
NFELLLGPICLPLVDRFIQLLKVAQASSSQYFRESILNDIRKARNLYTGKELAAELARIR
QRVDNIEVLTADIVINLLLSYRDIQDYDSIVKLVETLEKLPTFDLASHHHVKFHYAFALN
RRNLPGDRAKALDIMIPMVQSEGQVASDMYCLVGRIYKDMFLDSNFTDTESRDHGASWFK
KAFESEPTLQSGINYAVLLLAAGHQFESSFELRKVGVKLSSLLGKKGNLEKLQSYWEVGF
FLGASVLANDHMRVIQASEKLFKLKTPAWYLKSIVETILIYKHFVKLTTEQPVAKQELVD
FWMDFLVEATKTDVTVVRFPVLILEPTKIYQPSYLSINNEVEEKTISIWHVLPDDKKGIH
EWNFSASSVRGVSISKFEERCCFLYVLHNSDDFQIYFCTELHCKKFFEMVNTITEEKGRS
TEEGDCESDLLEYDYEYDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQ
PLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTI
GFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFT
GTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVH
PEIPESMSAEAKAFILKCFEPDPDKRACANDLLVDEFLKVSSKKKKTQPKLSALSAGSNE
YLRSISLPVPVLVEDTSSSSEYGSVSPDTELKVDPFSFKTRAKSCGERDVKGIRTLFLGI
PDENFEDHSAPPSPEEKDSGFFMLRKDSERRATLHRILTEDQDKIVRNLMESLAQGAEEP
KLKWEHITTLIASLREFVRSTDRKIIATTLSKLKLELDFDSHGISQVQVVLFGFQDAVNK
VLRNHNIKPHWMFALDSIIRKAVQTAITILVPELRPHFSLASESDTADQEDLDVEDDHEE
QPSNQTVRRPQAVIEDAVATSGVSTLSSTVSHDSQSAHRSLNVQLGRMKIETNRLLEELV
RKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVN
GADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZZH6	0.582	0.580	0.000	1379	0.934	0.931	D3ZZH6.pdb.gz	D3ZZH6_RAT mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k5 PE=1 SV=4
2	AFDB:O95382	0.484	0.514	0.000	1288	0.440	0.470	O95382.pdb.gz	M3K6_HUMAN Mitogen-activated protein kinase kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP3K6 PE=1 SV=3
3	AFDB:Q9VDS9	0.478	0.481	3.891E-98	1363	0.396	0.399	Q9VDS9.pdb.gz	Q9VDS9_DROME Apoptotic signal-regulating kinase 1, isoform C OS=Drosophila melanogaster OX=7227 GN=Ask1 PE=1 SV=3
4	AFDB:E7ESA6	0.188	0.231	5.011E-19	1096	0.103	0.130	E7ESA6.pdb.gz	E7ESA6_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=1
5	AFDB:F4HRJ4	0.194	0.428	5.011E-19	609	0.094	0.212	F4HRJ4.pdb.gz	M3K3A_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana OX=3702 GN=MAPKKK3 PE=1 SV=1
6	AFDB:F4JVS7	0.182	0.538	1.181E-18	444	0.086	0.266	F4JVS7.pdb.gz	F4JVS7_ARATH Mitogen-activated protein kinase kinase kinase 16 OS=Arabidopsis thaliana OX=3702 GN=MAPKKK16 PE=3 SV=1
7	AFDB:O08648	0.187	0.162	3.033E-18	1597	0.148	0.127	O08648.pdb.gz	M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus OX=10090 GN=Map3k4 PE=1 SV=2
8	AFDB:A0A1D8PHB0	0.185	0.224	6.286E-18	1126	0.099	0.121	A0A1D8PHB0.pdb.gz	A0A1D8PHB0_CANAL Serine/threonine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC15 PE=4 SV=1
9	AFDB:M4MD44	0.165	0.457	8.487E-18	474	0.071	0.205	M4MD44.pdb.gz	M4MD44_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=akt1 PE=1 SV=1
10	AFDB:Q8MSQ4	0.202	0.179	1.007E-17	1571	0.136	0.119	Q8MSQ4.pdb.gz	Q8MSQ4_DROME Mekk1, isoform B OS=Drosophila melanogaster OX=7227 GN=Mekk1 PE=2 SV=1
11	PDB:4krcA	0.173	0.746	1.482E-14	297	0.061	0.283	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
12	PDB:5u6yA	0.173	0.495	1.615E-14	459	0.060	0.181	5u6yA.pdb.gz
13	PDB:3eqdA	0.176	0.698	1.686E-14	315	0.064	0.279	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
14	PDB:4yc3A	0.173	0.746	2.588E-14	295	0.052	0.244	4yc3A.pdb.gz
15	PDB:4eomC	0.173	0.792	3.207E-14	276	0.058	0.290	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
16	PDB:5ufuA	0.174	0.618	4.923E-14	369	0.054	0.201	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
17	PDB:1unlA	0.175	0.761	5.844E-14	292	0.052	0.247	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
18	PDB:4zhxA	0.172	0.554	8.235E-14	409	0.055	0.186	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
19	PDB:6s9wA	0.168	0.495	1.438E-13	411	0.067	0.224	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
20	PDB:6b1uA	0.172	0.517	1.635E-13	442	0.055	0.170	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A280	0.0	2595	1373	0.936	0.937	A0A8I6A280_RAT mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k5 PE=1 SV=1
2	A0A8I6AEL0	0.0	2605	1381	0.937	0.933	A0A8I6AEL0_RAT mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k5 PE=1 SV=1
3	D3ZW27	0.0	2475	1365	0.904	0.910	D3ZW27_RAT mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k5 PE=1 SV=4
4	D3ZZH6	0.0	2619	1381	0.942	0.937	D3ZZH6_RAT mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k5 PE=1 SV=4
5	O35099	0.0	2626	1380	0.945	0.941	M3K5_MOUSE Mitogen-activated protein kinase kinase kinase 5 OS=Mus musculus OX=10090 GN=Map3k5 PE=1 SV=3
6	O95382	0.0	1138	1288	0.448	0.478	M3K6_HUMAN Mitogen-activated protein kinase kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP3K6 PE=1 SV=3
7	Q21029	0.0	742	1498	0.290	0.266	NSY1_CAEEL Mitogen-activated protein kinase kinase kinase nsy-1 OS=Caenorhabditis elegans OX=6239 GN=nsy-1 PE=1 SV=4
8	Q24458	0.0	567	650	0.219	0.463	Q24458_DROME Protein kinase OS=Drosophila melanogaster OX=7227 GN=Ask1 PE=2 SV=1
9	Q7KSB7	0.0	862	1196	0.363	0.417	Q7KSB7_DROME Apoptotic signal-regulating kinase 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Ask1 PE=1 SV=1
10	Q8I6M5	0.0	941	1367	0.402	0.405	Q8I6M5_DROME DASK1 OS=Drosophila melanogaster OX=7227 GN=Ask1 PE=2 SV=1
11	Q99683	0.0	2854	1374	1.000	1.000	M3K5_HUMAN Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens OX=9606 GN=MAP3K5 PE=1 SV=1
12	Q9VDS9	0.0	940	1363	0.402	0.406	Q9VDS9_DROME Apoptotic signal-regulating kinase 1, isoform C OS=Drosophila melanogaster OX=7227 GN=Ask1 PE=1 SV=3
13	Q9WTR2	0.0	1115	1291	0.442	0.470	M3K6_MOUSE Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus OX=10090 GN=Map3k6 PE=1 SV=4
14	Q40541	8.92e-59	218	690	0.090	0.180	NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum OX=4097 GN=NPK1 PE=1 SV=1
15	O22040	9.55e-58	214	666	0.089	0.183	ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana OX=3702 GN=ANP1 PE=1 SV=2
16	O22042	2.23e-56	210	651	0.087	0.184	M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana OX=3702 GN=ANP3 PE=1 SV=1
17	Q9FZ36	4.61e-55	206	651	0.082	0.172	M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana OX=3702 GN=ANP2 PE=2 SV=1
18	Q54R82	1.10e-54	210	942	0.082	0.119	MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum OX=44689 GN=mkkA PE=1 SV=2
19	Q39008	6.96e-49	187	608	0.085	0.192	M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana OX=3702 GN=MEKK1 PE=1 SV=2
20	F4HRJ4	2.54e-47	182	609	0.080	0.181	M3K3A_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana OX=3702 GN=MAPKKK3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19039 ASK_PH	8.1e-37	137.0	ASK kinase PH domain
2	PF20309 DRHyd-ASK	1e-13	62.3	Deoxyribohydrolase (DRHyd) domain of the ASK signalosome
3	PF05911 FPP	1.3	18.9	Filament-like plant protein, long coiled-coil
4	PF20302 HisK-N-like	1.4e-44	163.0	HisK-N-like globin domain of the ASK signalosome
5	PF14531 Kinase-like	3.6	18.4	Kinase-like
6	PF13281 MAP3K_TRAF_bd	3.5e-159	541.4	MAP3K TRAFs-binding domain
7	PF00069 Pkinase	4.8e-61	218.0	Protein kinase domain
8	PF17667 Pkinase_fungal	3	18.1	Fungal protein kinase
9	PF07714 PK_Tyr_Ser-Thr	2.6e-38	143.4	Protein tyrosine and serine/threonine kinase
10	PF20308 TPR-S	1.8e-15	68.7	Tetratricopeptide Repeats-Sensor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351908

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000247668	0.999	TNF receptor-associated factor 2
2	9606.ENSP00000259371	0.999	Disabled homolog 2-interacting protein
3	9606.ENSP00000363641	0.999	Thioredoxin
4	9606.ENSP00000363668	0.999	Death domain-associated protein 6
5	9606.ENSP00000433623	0.999	TNF receptor-associated factor 6
6	9606.ENSP00000418770	0.996	Protein/nucleic acid deglycase DJ-1
7	9606.ENSP00000451828	0.996	RAC-alpha serine/threonine-protein kinase
8	9606.ENSP00000311469	0.993	Glutathione S-transferase Mu 1
9	9606.ENSP00000410402	0.990	Dual specificity mitogen-activated protein kinase kinase 4
10	9606.ENSP00000379287	0.989	14-3-3 protein zeta/delta
11	9606.ENSP00000263826	0.988	RAC-gamma serine/threonine-protein kinase
12	9606.ENSP00000384849	0.986	Cyclin-dependent kinase inhibitor 1
13	9606.ENSP00000468348	0.984	Dual specificity mitogen-activated protein kinase kinase 6
14	9606.ENSP00000345083	0.983	Dual specificity mitogen-activated protein kinase kinase 3
15	9606.ENSP00000403701	0.981	Beta-arrestin-2
16	9606.ENSP00000347979	0.977	Tumor necrosis factor receptor superfamily member 6
17	9606.ENSP00000401445	0.973	Serine/threonine-protein kinase/endoribonuclease IRE1
18	9606.ENSP00000369314	0.971	Glutaredoxin-1
19	9606.ENSP00000419591	0.971	Mitogen-activated protein kinase kinase kinase 6
20	9606.ENSP00000398698	0.970	Tumor necrosis factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004709	1.000	MAP kinase kinase kinase activity
GO:0019899	0.813	enzyme binding
GO:0019900	0.463	kinase binding
GO:0019901	0.439	protein kinase binding
GO:1901363	0.395	heterocyclic compound binding
GO:0097159	0.395	organic cyclic compound binding
GO:0036094	0.395	small molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0031323	0.996	regulation of cellular metabolic process
GO:0048583	0.995	regulation of response to stimulus
GO:0080090	0.995	regulation of primary metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0043067	0.995	regulation of programmed cell death
GO:0051403	0.995	stress-activated MAPK cascade
GO:0006915	0.994	apoptotic process
GO:0043065	0.994	positive regulation of apoptotic process
GO:0034976	0.993	response to endoplasmic reticulum stress
GO:0007254	0.992	JNK cascade
GO:0070301	0.992	cellular response to hydrogen peroxide
GO:0043506	0.992	regulation of JUN kinase activity
GO:0045860	0.992	positive regulation of protein kinase activity
GO:0009966	0.989	regulation of signal transduction
GO:1902531	0.981	regulation of intracellular signal transduction
GO:1904705	0.979	regulation of vascular associated smooth muscle cell proliferation
GO:0071356	0.977	cellular response to tumor necrosis factor
GO:0048584	0.976	positive regulation of response to stimulus
GO:0010660	0.974	regulation of muscle cell apoptotic process
GO:0002931	0.967	response to ischemia
GO:0043406	0.965	positive regulation of MAP kinase activity
GO:0043507	0.959	positive regulation of JUN kinase activity
GO:0008284	0.954	positive regulation of cell population proliferation
GO:0032874	0.946	positive regulation of stress-activated MAPK cascade
GO:0008152	0.806	metabolic process
GO:0071704	0.713	organic substance metabolic process
GO:0042060	0.682	wound healing
GO:0044238	0.677	primary metabolic process
GO:0044237	0.662	cellular metabolic process
GO:0006807	0.659	nitrogen compound metabolic process
GO:0043170	0.580	macromolecule metabolic process
GO:1901564	0.568	organonitrogen compound metabolic process
GO:0019538	0.562	protein metabolic process
GO:0010468	0.475	regulation of gene expression
GO:0019219	0.428	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.421	regulation of biosynthetic process
GO:0036211	0.417	protein modification process
GO:0010556	0.403	regulation of macromolecule biosynthetic process
GO:0031326	0.403	regulation of cellular biosynthetic process
GO:0048519	0.402	negative regulation of biological process
GO:0051252	0.391	regulation of RNA metabolic process
GO:0048523	0.385	negative regulation of cellular process
GO:0006355	0.376	regulation of DNA-templated transcription
GO:0006796	0.307	phosphate-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005886	0.998	plasma membrane
GO:0009897	0.980	external side of plasma membrane
GO:0043226	0.789	organelle
GO:0043231	0.685	intracellular membrane-bounded organelle
GO:0032991	0.362	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.25	1.000	mitogen-activated protein kinase kinase kinase.

[back to server]