StarFunc result for job id Q99684

User Input

>input (422 residues)
MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQ
LTEAPDRASASPDSCEGSVCERSSEFEDFWRPPSPSASPASEKSMCPSLDEAQPFPLPFK
PYSWSGLAGSDLRHLVQSYRPCGALERGAGLGLFCEPAPEPGHPAALYGPKRAAGGAGAG
APGSCSAGAGATAGPGLGLYGDFGSAAAGLYERPTAAAGLLYPERGHGLHADKGAGVKVE
SELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLE
QHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTF
IHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHG
LK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99684	1.000	1.000	1.765E-66	422	1.000	1.000	Q99684.pdb.gz	GFI1_HUMAN Zinc finger protein Gfi-1 OS=Homo sapiens OX=9606 GN=GFI1 PE=1 SV=2
2	AFDB:P70338	0.471	0.470	2.129E-56	423	0.874	0.872	P70338.pdb.gz	GFI1_MOUSE Zinc finger protein Gfi-1 OS=Mus musculus OX=10090 GN=Gfi1 PE=1 SV=2
3	AFDB:O70237	0.424	0.540	3.604E-32	330	0.469	0.600	O70237.pdb.gz	GFI1B_MOUSE Zinc finger protein Gfi-1b OS=Mus musculus OX=10090 GN=Gfi1b PE=1 SV=1
4	AFDB:Q9H7X3	0.366	0.410	2.399E-21	374	0.242	0.273	Q9H7X3.pdb.gz	ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens OX=9606 GN=ZNF696 PE=1 SV=2
5	AFDB:A0A1B0GR71	0.353	0.166	5.816E-21	966	0.235	0.102	A0A1B0GR71.pdb.gz	A0A1B0GR71_MOUSE Predicted gene 4924 OS=Mus musculus OX=10090 GN=Gm4924 PE=1 SV=1
6	AFDB:Q5DTF8	0.363	0.174	2.756E-19	919	0.199	0.091	Q5DTF8.pdb.gz	Q5DTF8_MOUSE MKIAA4236 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfp748 PE=2 SV=1
7	AFDB:Q8TAF7	0.391	0.297	2.756E-19	563	0.206	0.155	Q8TAF7.pdb.gz	ZN461_HUMAN Zinc finger protein 461 OS=Homo sapiens OX=9606 GN=ZNF461 PE=1 SV=2
8	AFDB:Q96SZ4	0.257	0.165	2.756E-19	725	0.280	0.163	Q96SZ4.pdb.gz	ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ZSCAN10 PE=1 SV=1
9	AFDB:P17023	0.374	0.347	2.936E-19	458	0.185	0.170	P17023.pdb.gz	ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens OX=9606 GN=ZNF19 PE=1 SV=4
10	AFDB:Q9UFB7	0.319	0.186	8.077E-19	747	0.273	0.154	Q9UFB7.pdb.gz	ZBT47_HUMAN Zinc finger and BTB domain-containing protein 47 OS=Homo sapiens OX=9606 GN=ZBTB47 PE=1 SV=3
11	PDB:3w5kB	0.109	0.266	4.846E-5	110	0.090	0.345	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7uhyC	0.054	0.042	3.620E-1	578	0.047	0.035	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
13	PDB:6ydhA	0.048	0.240	6.004E-1	62	0.033	0.226	6ydhA.pdb.gz
14	PDB:7ad8D	0.062	0.086	9.348E-1	280	0.052	0.079	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
15	PDB:4fjcE	0.065	0.063	1.130	434	0.069	0.067	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
16	PDB:2yv7A	0.070	0.104	1.760	235	0.050	0.089	2yv7A.pdb.gz	Comparison of vertebrate and invertebrate CLIC proteins: The crystal structures of Caenorhabditis elegans EXC-4 and Drosophila melanogaster DmCLIC
17	PDB:5a31B	0.062	0.214	1.875	84	0.028	0.143	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
18	PDB:1a0fA	0.074	0.139	1.997	201	0.043	0.090	1a0fA.pdb.gz	Three-dimensional structure of Escherichia coli glutathione S-transferase complexed with glutathione sulfonate: catalytic roles of Cys10 and His106.
19	PDB:5gm6a	0.043	0.115	1.997	123	0.038	0.130	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
20	PDB:7oniH	0.064	0.068	2.266	380	0.057	0.063	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P70338	0.0	711	423	0.874	0.872	GFI1_MOUSE Zinc finger protein Gfi-1 OS=Mus musculus OX=10090 GN=Gfi1 PE=1 SV=2
2	Q07120	0.0	714	423	0.877	0.875	GFI1_RAT Zinc finger protein Gfi-1 OS=Rattus norvegicus OX=10116 GN=Gfi1 PE=1 SV=1
3	Q99684	0.0	853	422	1.000	1.000	GFI1_HUMAN Zinc finger protein Gfi-1 OS=Homo sapiens OX=9606 GN=GFI1 PE=1 SV=2
4	Q7SZV1	1.47e-172	490	396	0.649	0.692	Q7SZV1_DANRE Growth factor independent 1 OS=Danio rerio OX=7955 GN=gfi1.2 PE=2 SV=1
5	Q501T1	2.41e-160	458	385	0.595	0.652	Q501T1_DANRE Gfi1.1 protein OS=Danio rerio OX=7955 GN=gfi1.1 PE=2 SV=1
6	O70237	9.79e-111	330	330	0.358	0.458	GFI1B_MOUSE Zinc finger protein Gfi-1b OS=Mus musculus OX=10090 GN=Gfi1b PE=1 SV=1
7	Q5VTD9	2.36e-110	329	330	0.358	0.458	GFI1B_HUMAN Zinc finger protein Gfi-1b OS=Homo sapiens OX=9606 GN=GFI1B PE=1 SV=1
8	E7FBX7	2.06e-106	319	334	0.367	0.464	E7FBX7_DANRE Growth factor-independent 1B transcription repressor OS=Danio rerio OX=7955 GN=si:ch211-231o6.2 PE=4 SV=1
9	A0A024R8F3	8.65e-105	316	352	0.358	0.429	A0A024R8F3_HUMAN Growth factor independent 1B (Potential regulator of CDKN1A, translocated in CML), isoform CRA_a OS=Homo sapiens OX=9606 GN=GFI1B PE=1 SV=1
10	A0A1B0GTD0	1.99e-103	313	362	0.358	0.417	A0A1B0GTD0_HUMAN Growth factor independent 1B transcriptional repressor OS=Homo sapiens OX=9606 GN=GFI1B PE=1 SV=1
11	G5EDE1	1.01e-75	241	336	0.251	0.315	GFI1H_CAEEL Zinc finger protein GFI1 homolog pag-3 OS=Caenorhabditis elegans OX=6239 GN=pag-3 PE=1 SV=1
12	Q9N658	6.16e-64	216	541	0.227	0.177	GFI1_DROME Zinc finger protein sens OS=Drosophila melanogaster OX=7227 GN=sens PE=1 SV=1
13	Q9ESP5	1.69e-47	170	455	0.204	0.189	FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus OX=10090 GN=Fezf2 PE=1 SV=1
14	M9PBS1	1.24e-46	171	603	0.180	0.126	M9PBS1_DROME Earmuff, isoform B OS=Drosophila melanogaster OX=7227 GN=erm PE=4 SV=1
15	Q9VQ56	1.30e-46	171	611	0.180	0.124	ERM_DROME Fez family zinc finger protein erm OS=Drosophila melanogaster OX=7227 GN=erm PE=1 SV=2
16	M9PB02	1.82e-46	171	654	0.180	0.116	M9PB02_DROME Earmuff, isoform C OS=Drosophila melanogaster OX=7227 GN=erm PE=4 SV=1
17	Q804Q5	1.87e-46	167	430	0.185	0.181	FEZF2_DANRE Fez family zinc finger protein 2 OS=Danio rerio OX=7955 GN=fezf2 PE=1 SV=2
18	A0A0R4YI50	2.09e-46	171	698	0.180	0.109	A0A0R4YI50_DROME Earmuff, isoform D OS=Drosophila melanogaster OX=7227 GN=erm PE=4 SV=1
19	P10754	1.80e-45	166	512	0.282	0.232	RHIT_MOUSE Transcriptional repressor Rhit OS=Mus musculus OX=10090 GN=Zfp13 PE=1 SV=2
20	A0PJY2	2.20e-45	165	475	0.185	0.164	FEZF1_HUMAN Fez family zinc finger protein 1 OS=Homo sapiens OX=9606 GN=FEZF1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01363 FYVE	5.2e+02	12.2	FYVE zinc finger
2	PF09237 GAGA	1.7e+02	13.6	GAGA factor
3	PF11494 Ta0938	5.4e+02	12.4	Ta0938
4	PF02892 zf-BED	0.15	23.4	BED zinc finger
5	PF00096 zf-C2H2	7.1e-25	97.2	Zinc finger, C2H2 type
6	PF16622 zf-C2H2_11	4.1e+02	12.2	zinc-finger C2H2-type
7	PF18868 zf-C2H2_3rep	22	17.2	Zinc finger C2H2-type, 3 repeats
8	PF13894 zf-C2H2_4	7.1e-19	77.9	C2H2-type zinc finger
9	PF13912 zf-C2H2_6	2.9e-10	51.1	C2H2-type zinc finger
10	PF12171 zf-C2H2_jaz	2.2e-12	58.1	Zinc-finger double-stranded RNA-binding
11	PF10276 zf-CHCC	6.1e+02	11.9	Zinc-finger domain
12	PF05605 zf-Di19	12	17.6	Drought induced 19 protein (Di19), zinc-binding
13	PF13465 zf-H2C2_2	5.1e-24	94.8	Zinc-finger double domain
14	PF12874 zf-met	0.00061	31.3	Zinc-finger of C2H2 type
15	PF18439 zf_UBZ	1.7e+02	13.3	Ubiquitin-Binding Zinc Finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359357

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383042	0.992	Lysine-specific histone demethylase 1A
2	9606.ENSP00000262241	0.977	REST corepressor 1
3	9606.ENSP00000479618	0.965	Myc proto-oncogene protein
4	9606.ENSP00000427514	0.958	CCAAT/enhancer-binding protein alpha
5	9606.ENSP00000227163	0.951	Transcription factor PU.1
6	9606.ENSP00000364885	0.929	Zinc finger and BTB domain-containing protein 17
7	9606.ENSP00000345681	0.926	Endothelial transcription factor GATA-2
8	9606.ENSP00000264709	0.920	DNA (cytosine-5)-methyltransferase 3A
9	9606.ENSP00000294339	0.908	T-cell acute lymphocytic leukemia protein 1
10	9606.ENSP00000362649	0.906	Histone deacetylase 1
11	9606.ENSP00000351490	0.902	Protein max
12	9606.ENSP00000376765	0.894	E3 SUMO-protein ligase PIAS3
13	9606.ENSP00000339992	0.852	Transcriptional activator Myb
14	9606.ENSP00000230732	0.826	POU domain, class 4, transcription factor 3
15	9606.ENSP00000430432	0.821	Histone deacetylase 2
16	9606.ENSP00000244769	0.820	Ataxin-1
17	9606.ENSP00000364678	0.810	Histone-lysine N-methyltransferase EHMT2
18	9606.ENSP00000359356	0.805	Ecotropic viral integration site 5 protein homolog
19	9606.ENSP00000300305	0.804	Runt-related transcription factor 1
20	9606.ENSP00000265165	0.798	Lymphoid enhancer-binding factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001227	0.999	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000976	0.995	transcription cis-regulatory region binding
GO:0000977	0.530	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.449	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0080090	0.987	regulation of primary metabolic process
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0031323	0.986	regulation of cellular metabolic process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0006355	0.983	regulation of DNA-templated transcription
GO:0048519	0.972	negative regulation of biological process
GO:0048523	0.964	negative regulation of cellular process
GO:0006357	0.941	regulation of transcription by RNA polymerase II
GO:0009987	0.921	cellular process
GO:0009892	0.917	negative regulation of metabolic process
GO:0051172	0.910	negative regulation of nitrogen compound metabolic process
GO:0009890	0.907	negative regulation of biosynthetic process
GO:0010605	0.902	negative regulation of macromolecule metabolic process
GO:1902679	0.887	negative regulation of RNA biosynthetic process
GO:1903507	0.877	negative regulation of nucleic acid-templated transcription
GO:0050896	0.862	response to stimulus
GO:0045892	0.860	negative regulation of DNA-templated transcription
GO:0048518	0.857	positive regulation of biological process
GO:0048522	0.792	positive regulation of cellular process
GO:0000122	0.774	negative regulation of transcription by RNA polymerase II
GO:0051716	0.639	cellular response to stimulus
GO:0032501	0.535	multicellular organismal process
GO:0048856	0.527	anatomical structure development
GO:0009893	0.512	positive regulation of metabolic process
GO:0010604	0.471	positive regulation of macromolecule metabolic process
GO:0031325	0.469	positive regulation of cellular metabolic process
GO:0051173	0.452	positive regulation of nitrogen compound metabolic process
GO:0048583	0.374	regulation of response to stimulus
GO:0045893	0.341	positive regulation of DNA-templated transcription
GO:0007275	0.327	multicellular organism development
GO:0065009	0.312	regulation of molecular function
GO:0070887	0.312	cellular response to chemical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.743	protein-containing complex
GO:0005667	0.719	transcription regulator complex
GO:0005737	0.701	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]