StarFunc result for job id Q99685

User Input

>input (303 residues)
MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEE
LARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLG
HSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPID
SSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADR
LCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTA
SPP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0C4DFN3	0.971	0.940	3.474E-64	313	1.000	0.968	A0A0C4DFN3.pdb.gz	A0A0C4DFN3_HUMAN Monoglyceride lipase OS=Homo sapiens OX=9606 GN=MGLL PE=1 SV=1
2	PDB:7prmA	0.956	0.982	1.161E-60	295	0.957	0.983	7prmA.pdb.gz	Development of High Brain-Penetrant and Reversible Monoacylglycerol Lipase PET Tracers for Neuroimaging.
3	AFDB:O35678	0.968	0.968	5.314E-60	303	0.842	0.842	O35678.pdb.gz	MGLL_MOUSE Monoglyceride lipase OS=Mus musculus OX=10090 GN=Mgll PE=1 SV=1
4	AFDB:O07427	0.816	0.883	2.046E-30	279	0.314	0.341	O07427.pdb.gz	MGLL_MYCTU Monoacylglycerol lipase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0183 PE=1 SV=2
5	PDB:6eicB	0.807	0.874	3.388E-30	279	0.314	0.341	6eicB.pdb.gz
6	AFDB:Q57Y40	0.856	0.838	1.371E-29	310	0.314	0.306	Q57Y40.pdb.gz	Q57Y40_TRYB2 Monoglyceride lipase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.80 PE=4 SV=1
7	AFDB:A0QNZ7	0.821	0.885	1.982E-29	280	0.290	0.314	A0QNZ7.pdb.gz	MGLL_MYCS2 Monoacylglycerol lipase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_0220 PE=1 SV=1
8	AFDB:Q57U43	0.831	0.803	2.041E-28	314	0.304	0.293	Q57U43.pdb.gz	Q57U43_TRYB2 Monoglyceride lipase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.6H23.290 PE=4 SV=1
9	AFDB:B3H7N1	0.826	0.687	8.903E-28	369	0.277	0.228	B3H7N1.pdb.gz	B3H7N1_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL15 PE=1 SV=1
10	AFDB:Q9LYG5	0.835	0.656	1.138E-27	390	0.284	0.221	Q9LYG5.pdb.gz	Q9LYG5_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL13 PE=1 SV=1
11	AFDB:O80628	0.843	0.808	1.859E-27	317	0.264	0.252	O80628.pdb.gz	O80628_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL7 PE=1 SV=2
12	AFDB:O22248	0.846	0.735	4.129E-27	351	0.257	0.222	O22248.pdb.gz	O22248_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL9 PE=1 SV=2
13	PDB:4zwnB	0.807	0.788	4.420E-21	311	0.221	0.215	4zwnB.pdb.gz
14	PDB:3kxpA	0.606	0.676	9.750E-15	268	0.182	0.205	3kxpA.pdb.gz
15	PDB:5xb6A	0.689	0.683	4.000E-14	306	0.155	0.154	5xb6A.pdb.gz
16	PDB:2y6vC	0.589	0.487	1.365E-13	377	0.195	0.156	2y6vC.pdb.gz
17	PDB:1q0rA	0.589	0.599	3.644E-13	297	0.165	0.168	1q0rA.pdb.gz	Crystal structure of aclacinomycin methylesterase with bound product analogues: implications for anthracycline recognition and mechanism.
18	PDB:2qvbB	0.641	0.652	1.406E-12	297	0.165	0.168	2qvbB.pdb.gz
19	PDB:2ocgA	0.582	0.681	3.530E-12	254	0.182	0.217	2ocgA.pdb.gz	Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.
20	PDB:3afiB	0.618	0.620	3.530E-12	302	0.168	0.169	3afiB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DFN3	0.0	625	313	1.000	0.968	A0A0C4DFN3_HUMAN Monoglyceride lipase OS=Homo sapiens OX=9606 GN=MGLL PE=1 SV=1
2	A0A3B3ITT3	0.0	539	262	0.865	1.000	A0A3B3ITT3_HUMAN Monoglyceride lipase OS=Homo sapiens OX=9606 GN=MGLL PE=1 SV=1
3	O35678	0.0	548	303	0.842	0.842	MGLL_MOUSE Monoglyceride lipase OS=Mus musculus OX=10090 GN=Mgll PE=1 SV=1
4	Q8R431	0.0	540	303	0.838	0.838	MGLL_RAT Monoglyceride lipase OS=Rattus norvegicus OX=10116 GN=Mgll PE=1 SV=1
5	Q99685	0.0	625	303	1.000	1.000	MGLL_HUMAN Monoglyceride lipase OS=Homo sapiens OX=9606 GN=MGLL PE=1 SV=2
6	H7C4E0	3.06e-122	350	209	0.594	0.861	H7C4E0_HUMAN Monoglyceride lipase (Fragment) OS=Homo sapiens OX=9606 GN=MGLL PE=1 SV=1
7	O07427	2.96e-50	169	279	0.314	0.341	MGLL_MYCTU Monoacylglycerol lipase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0183 PE=1 SV=2
8	A0QNZ7	3.19e-44	154	280	0.294	0.318	MGLL_MYCS2 Monoacylglycerol lipase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_0220 PE=1 SV=1
9	Q57Y40	1.93e-40	145	310	0.310	0.303	Q57Y40_TRYB2 Monoglyceride lipase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.80 PE=4 SV=1
10	Q57U43	5.85e-37	135	314	0.314	0.303	Q57U43_TRYB2 Monoglyceride lipase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.6H23.290 PE=4 SV=1
11	Q94AM5	6.85e-35	133	463	0.310	0.203	Q94AM5_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL4 PE=1 SV=1
12	Q9LYG5	1.28e-34	131	390	0.290	0.226	Q9LYG5_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL13 PE=1 SV=1
13	Q8VYJ0	1.76e-34	130	382	0.304	0.241	Q8VYJ0_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL2 PE=1 SV=1
14	Q8RXN7	3.01e-34	129	317	0.314	0.300	Q8RXN7_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL8 PE=1 SV=1
15	O80628	1.86e-33	126	317	0.284	0.271	O80628_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL7 PE=1 SV=2
16	O80627	3.08e-32	123	311	0.300	0.293	O80627_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL6 PE=1 SV=2
17	F4IZK0	8.87e-32	122	348	0.294	0.256	F4IZK0_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL12 PE=1 SV=1
18	B3H7N1	2.01e-31	122	369	0.294	0.241	B3H7N1_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL15 PE=1 SV=1
19	O22248	1.43e-30	119	351	0.297	0.256	O22248_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL9 PE=1 SV=2
20	Q9M3D1	3.25e-30	118	312	0.290	0.282	Q9M3D1_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MAGL10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00561 Abhydrolase_1	7.8e-09	47.1	alpha/beta hydrolase fold
2	PF20408 Abhydrolase_11	1.8e-06	39.3	Alpha/beta hydrolase domain
3	PF02230 Abhydrolase_2	39	15.5	Phospholipase/Carboxylesterase
4	PF07859 Abhydrolase_3	1.3	20.3	alpha/beta hydrolase fold
5	PF12695 Abhydrolase_5	25	16.1	Alpha/beta hydrolase family
6	PF12697 Abhydrolase_6	5.7e-10	51.7	Alpha/beta hydrolase family
7	PF01738 DLH	5.1	18.2	Dienelactone hydrolase family
8	PF06342 DUF1057	60	14.1	Alpha/beta hydrolase of unknown function (DUF1057)
9	PF07082 DUF1350	94	13.7	Protein of unknown function (DUF1350)
10	PF00756 Esterase	0.012	26.8	Putative esterase
11	PF12146 Hydrolase_4	2.1e-70	248.2	Serine aminopeptidase, S33
12	PF10230 LIDHydrolase	30	15.6	Lipid-droplet associated hydrolase
13	PF01764 Lipase_3	0.035	25.4	Lipase (class 3)
14	PF00326 Peptidase_S9	6.7	17.7	Prolyl oligopeptidase family
15	PF07819 PGAP1	6	18.1	PGAP1-like protein
16	PF00975 Thioesterase	6.6	18.4	Thioesterase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265052

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337701	0.983	Patatin-like phospholipase domain-containing protein 2
2	9606.ENSP00000309757	0.949	Lipoprotein lipase
3	9606.ENSP00000406674	0.945	2-acylglycerol O-acyltransferase 1
4	9606.ENSP00000198801	0.943	2-acylglycerol O-acyltransferase 2
5	9606.ENSP00000358223	0.938	Pancreatic lipase
6	9606.ENSP00000299022	0.936	Hepatic triacylglycerol lipase
7	9606.ENSP00000216180	0.932	Patatin-like phospholipase domain-containing protein 3
8	9606.ENSP00000401720	0.931	Glycerol kinase
9	9606.ENSP00000442464	0.931	Neutral cholesterol ester hydrolase 1
10	9606.ENSP00000377900	0.929	Lipase F, gastric type
11	9606.ENSP00000243167	0.924	Fatty-acid amide hydrolase 1
12	9606.ENSP00000261292	0.923	Endothelial lipase
13	9606.ENSP00000361151	0.923	Bile salt-activated lipase
14	9606.ENSP00000347581	0.921	Acylglycerol kinase, mitochondrial
15	9606.ENSP00000223114	0.920	2-acylglycerol O-acyltransferase 3
16	9606.ENSP00000407112	0.917	N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D
17	9606.ENSP00000433933	0.914	Inactive pancreatic lipase-related protein 1
18	9606.ENSP00000351706	0.911	Glycerol kinase 2
19	9606.ENSP00000358232	0.904	Pancreatic lipase related protein 3
20	9606.ENSP00000352584	0.903	Aldo-keto reductase family 1 member B10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0047372	1.000	acylglycerol lipase activity
GO:0005515	0.996	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044255	0.996	cellular lipid metabolic process
GO:0046486	0.988	glycerolipid metabolic process
GO:0044242	0.987	cellular lipid catabolic process
GO:0046503	0.981	glycerolipid catabolic process
GO:0006631	0.947	fatty acid metabolic process
GO:0001676	0.936	long-chain fatty acid metabolic process
GO:0006639	0.916	acylglycerol metabolic process
GO:0046464	0.882	acylglycerol catabolic process
GO:0033559	0.866	unsaturated fatty acid metabolic process
GO:0019369	0.840	arachidonic acid metabolic process
GO:0065007	0.622	biological regulation
GO:0050789	0.583	regulation of biological process
GO:0050896	0.366	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0031974	0.996	membrane-enclosed lumen
GO:0070013	0.994	intracellular organelle lumen
GO:0005654	0.982	nucleoplasm
GO:0005737	0.944	cytoplasm
GO:0016020	0.942	membrane
GO:0031090	0.674	organelle membrane
GO:0012505	0.656	endomembrane system
GO:0005789	0.625	endoplasmic reticulum membrane
GO:0005886	0.516	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34019	1.000	a 1-acylglycerol + H2O = a fatty acid + glycerol + H(+)
EC:3.1.1.23	1.000	acylglycerol lipase.

[back to server]