StarFunc result for job id Q99698

User Input

>input (1400 residues)
MSTDSNSLAREFLTDVNRLCNAVVQRVEAREEEEEETHMATLGQYLVHGRGFLLLTKLNS
IIDQALTCREELLTLLLSLLPLVWKIPVQEEKATDFNLPLSADIILTKEKNSSSQRSTQE
KLHLEGSALSSQVSAKVNVFRKSRRQRKITHRYSVRDARKTQLSTSDSEANSDEKGIAMN
KHRRPHLLHHFLTSFPKQDHPKAKLDRLATKEQTPPDAMALENSREIIPRQGSNTDILSE
PAALSVISNMNNSPFDLCHVLLSLLEKVCKFDVTLNHNSPLAASVVPTLTEFLAGFGDCC
SLSDNLESRVVSAGWTEEPVALIQRMLFRTVLHLLSVDVSTAEMMPENLRKNLTELLRAA
LKIRICLEKQPDPFAPRQKKTLQEVQEDFVFSKYRHRALLLPELLEGVLQILICCLQSAA
SNPFYFSQAMDLVQEFIQHHGFNLFETAVLQMEWLVLRDGVPPEASEHLKALINSVMKIM
STVKKVKSEQLHHSMCTRKRHRRCEYSHFMHHHRDLSGLLVSAFKNQVSKNPFEETADGD
VYYPERCCCIAVCAHQCLRLLQQASLSSTCVQILSGVHNIGICCCMDPKSVIIPLLHAFK
LPALKNFQQHILNILNKLILDQLGGAEISPKIKKAACNICTVDSDQLAQLEETLQGNLCD
AELSSSLSSPSYRFQGILPSSGSEDLLWKWDALKAYQNFVFEEDRLHSIQIANHICNLIQ
KGNIVVQWKLYNYIFNPVLQRGVELAHHCQHLSVTSAQSHVCSHHNQCLPQDVLQIYVKT
LPILLKSRVIRDLFLSCNGVSQIIELNCLNGIRSHSLKAFETLIISLGEQQKDASVPDID
GIDIEQKELSSVHVGTSFHHQQAYSDSPQSLSKFYAGLKEAYPKRRKTVNQDVHINTINL
FLCVAFLCVSKEAESDRESANDSEDTSGYDSTASEPLSHMLPCISLESLVLPSPEHMHQA
ADIWSMCRWIYMLSSVFQKQFYRLGGFRVCHKLIFMIIQKLFRSHKEEQGKKEGDTSVNE
NQDLNRISQPKRTMKEDLLSLAIKSDPIPSELGSLKKSADSLGKLELQHISSINVEEVSA
TEAAPEEAKLFTSQESETSLQSIRLLEALLAICLHGARTSQQKMELELPNQNLSVESILF
EMRDHLSQSKVIETQLAKPLFDALLRVALGNYSADFEHNDAMTEKSHQSAEELSSQPGDF
SEEAEDSQCCSFKLLVEEEGYEADSESNPEDGETQDDGVDLKSETEGFSASSSPNDLLEN
LTQGEIIYPEICMLELNLLSASKAKLDVLAHVFESFLKIIRQKEKNVFLLMQQGTVKNLL
GGFLSILTQDDSDFQACQRVLVDLLVSLMSSRTCSEELTLLLRIFLEKSPCTKILLLGIL
KIIESDTTMSPSQYLTFPLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G5EGS5	0.149	0.118	3.872E-5	1975	0.138	0.098	G5EGS5.pdb.gz	GBF1_CAEEL Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 homolog OS=Caenorhabditis elegans OX=6239 GN=gbf-1 PE=3 SV=1
2	AFDB:Q8RWY6	0.121	0.119	7.706E-5	1439	0.104	0.101	Q8RWY6.pdb.gz	CLASP_ARATH CLIP-associated protein OS=Arabidopsis thaliana OX=3702 GN=CLASP PE=1 SV=1
3	PDB:7mq8LM	0.111	0.085	1.109E-4	2005	0.109	0.076	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
4	PDB:7jq9A	0.142	0.101	1.378E-4	2427	0.103	0.059	7jq9A.pdb.gz
5	AFDB:Q6DFZ1	0.158	0.131	1.427E-4	1861	0.139	0.105	Q6DFZ1.pdb.gz	Q6DFZ1_MOUSE Golgi-specific brefeldin A-resistance factor 1 OS=Mus musculus OX=10090 GN=Gbf1 PE=1 SV=1
6	PDB:4c0qA	0.166	0.239	2.551E-4	871	0.079	0.127	4c0qA.pdb.gz	Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
7	PDB:6bcuA	0.097	0.071	2.743E-4	2204	0.070	0.044	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
8	PDB:7r5jB0	0.126	0.112	4.085E-4	1748	0.100	0.080	7r5jB0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
9	PDB:7sukSP	0.132	0.100	4.236E-4	2234	0.086	0.054	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
10	PDB:7mopA	0.140	0.103	4.392E-4	2445	0.093	0.053	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
11	PDB:7mqaLM	0.061	0.048	4.722E-4	2041	0.102	0.070	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7sglA	0.091	0.053	5.077E-4	3852	0.101	0.037	7sglA.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
13	PDB:7t3rA	0.093	0.075	5.077E-4	2130	0.094	0.062	7t3rA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
14	AFDB:Q14669	0.122	0.095	7.282E-4	1992	0.097	0.068	Q14669.pdb.gz	TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1
15	AFDB:A7E2V4	0.103	0.088	1.897E-2	1837	0.112	0.085	A7E2V4.pdb.gz	ZSWM8_HUMAN Zinc finger SWIM domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZSWIM8 PE=1 SV=1
16	AFDB:Q9XVI2	0.130	0.196	2.826E-2	811	0.060	0.104	Q9XVI2.pdb.gz	Q9XVI2_CAEEL SYmmetrical Sister cell hermaphrodite gonad defect OS=Caenorhabditis elegans OX=6239 GN=sys-1 PE=1 SV=1
17	AFDB:C9JFV4	0.106	0.120	2.930E-2	1180	0.102	0.121	C9JFV4.pdb.gz	C9JFV4_HUMAN Proline-, glutamic acid- and leucine-rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=2
18	AFDB:Q8T626	0.091	0.099	4.060E-2	1240	0.131	0.148	Q8T626.pdb.gz	DLT_DROME Protein disks lost OS=Drosophila melanogaster OX=7227 GN=dlt PE=1 SV=2
19	AFDB:H2L0H5	0.127	0.201	4.866E-2	748	0.064	0.119	H2L0H5.pdb.gz	WAPL_CAEEL Wings apart-like protein homolog 1 OS=Caenorhabditis elegans OX=6239 GN=wapl-1 PE=3 SV=1
20	AFDB:Q6EDY6	0.055	0.055	5.625E-2	1374	0.094	0.095	Q6EDY6.pdb.gz	CARL1_MOUSE F-actin-uncapping protein LRRC16A OS=Mus musculus OX=10090 GN=Carmil1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K5V4	0.0	2257	3789	0.810	0.299	A0A0G2K5V4_RAT Lysosomal trafficking regulator OS=Rattus norvegicus OX=10116 GN=Lyst PE=1 SV=2
2	A0A8I5Y701	0.0	2257	3772	0.810	0.301	A0A8I5Y701_RAT Lysosomal trafficking regulator OS=Rattus norvegicus OX=10116 GN=Lyst PE=1 SV=1
3	A0A8I6B436	0.0	2256	3840	0.810	0.295	A0A8I6B436_RAT Lysosomal trafficking regulator OS=Rattus norvegicus OX=10116 GN=Lyst PE=1 SV=1
4	P97412	0.0	2263	3788	0.811	0.300	LYST_MOUSE Lysosomal-trafficking regulator OS=Mus musculus OX=10090 GN=Lyst PE=1 SV=1
5	Q99698	0.0	2865	3801	1.000	0.368	LYST_HUMAN Lysosomal-trafficking regulator OS=Homo sapiens OX=9606 GN=LYST PE=1 SV=3
6	Q9Z2X9	0.0	2240	3788	0.806	0.298	Q9Z2X9_RAT BEIGE OS=Rattus norvegicus OX=10116 GN=Lyst PE=2 SV=1
7	Q80X82	0.053	40.4	1288	0.020	0.022	SYMPK_MOUSE Symplekin OS=Mus musculus OX=10090 GN=Sympk PE=1 SV=2
8	Q92797	0.31	38.1	1274	0.015	0.016	SYMPK_HUMAN Symplekin OS=Homo sapiens OX=9606 GN=SYMPK PE=1 SV=2
9	A0A087WUE9	0.33	38.1	1058	0.015	0.020	A0A087WUE9_HUMAN Symplekin scaffold protein OS=Homo sapiens OX=9606 GN=SYMPK PE=1 SV=1
10	Q70FJ1	2.2	35.4	3797	0.016	0.006	AKAP9_MOUSE A-kinase anchor protein 9 OS=Mus musculus OX=10090 GN=Akap9 PE=1 SV=2
11	P16949	7.1	32.0	149	0.014	0.128	STMN1_HUMAN Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3
12	P54227	8.5	32.0	149	0.014	0.128	STMN1_MOUSE Stathmin OS=Mus musculus OX=10090 GN=Stmn1 PE=1 SV=2
13	Q96CE4	8.7	32.0	149	0.014	0.128	Q96CE4_HUMAN Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=1
14	P13668	9.3	31.6	149	0.014	0.128	STMN1_RAT Stathmin OS=Rattus norvegicus OX=10116 GN=Stmn1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000374443

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356602	0.875	Vacuolar protein sorting-associated protein VTA1 homolog
2	9606.ENSP00000207549	0.788	Protein unc-13 homolog D
3	9606.ENSP00000356540	0.781	Syntaxin-11
4	9606.ENSP00000413606	0.776	Syntaxin-binding protein 2
5	9606.ENSP00000255194	0.772	AP-3 complex subunit beta-1
6	9606.ENSP00000379601	0.746	Ras-related protein Rab-27A
7	9606.ENSP00000264187	0.736	Nidogen-1
8	9606.ENSP00000381213	0.688	Hermansky-Pudlak syndrome 4 protein
9	9606.ENSP00000349205	0.674	Phosphoinositide 3-kinase regulatory subunit 4
10	9606.ENSP00000282841	0.671	Geranylgeranyl pyrophosphate synthase
11	9606.ENSP00000309457	0.667	Vacuolar protein sorting-associated protein 41 homolog
12	9606.ENSP00000199280	0.664	Aquaporin-2
13	9606.ENSP00000360181	0.646	SH2 domain-containing protein 1A
14	9606.ENSP00000220531	0.642	Biogenesis of lysosome-related organelles complex 1 subunit 6
15	9606.ENSP00000266529	0.604	Zinc finger CCHC-type and RNA binding motif containing 1
16	9606.ENSP00000299238	0.601	Hermansky-Pudlak syndrome 6 protein
17	9606.ENSP00000359149	0.599	F-box/WD repeat-containing protein 4
18	9606.ENSP00000265967	0.589	Hermansky-Pudlak syndrome 5 protein
19	9606.ENSP00000238497	0.581	Vacuolar protein sorting-associated protein 4B
20	9606.ENSP00000296051	0.580	Hermansky-Pudlak syndrome 3 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0043473	0.985	pigmentation
GO:0009987	0.333	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.996	intracellular organelle
GO:0005737	0.990	cytoplasm
GO:0005829	0.967	cytosol
GO:0043232	0.820	intracellular non-membrane-bounded organelle
GO:0005856	0.614	cytoskeleton
GO:0043227	0.610	membrane-bounded organelle
GO:0043231	0.585	intracellular membrane-bounded organelle
GO:0015630	0.505	microtubule cytoskeleton
GO:0005634	0.492	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]