StarFunc result for job id Q99700

User Input

>input (1313 residues)
MRSAAAAPRSPAVATESRRFAAARWPGWRSLQRPARRSGRGGGGAAPGPYPSAAPPPPGP
GPPPSRQSSPPSASDCFGSNGNGGGAFRPGSRRLLGLGGPPRPFVVLLLPLASPGAPPAA
PTRASPLGARASPPRSGVSLARPAPGCPRPACEPVYGPLTMSLKPQQQQQQQQQQQQQQQ
QQQQQQQQPPPAAANVRKPGGSGLLASPAAAPSPSSSSVSSSSATAPSSVVAATSGGGRP
GLGRGRNSNKGLPQSTISFDGIYANMRMVHILTSVVGSKCEVQVKNGGIYEGVFKTYSPK
CDLVLDAAHEKSTESSSGPKREEIMESILFKCSDFVVVQFKDMDSSYAKRDAFTDSAISA
KVNGEHKEKDLEPWDAGELTANEELEALENDVSNGWDPNDMFRYNEENYGVVSTYDSSLS
SYTVPLERDNSEEFLKREARANQLAEEIESSAQYKARVALENDDRSEEEKYTAVQRNSSE
REGHSINTRENKYIPPGQRNREVISWGSGRQNSPRMGQPGSGSMPSRSTSHTSDFNPNSG
SDQRVVNGGVPWPSPCPSPSSRPPSRYQSGPNSLPPRAATPTRPPSRPPSRPSRPPSHPS
AHGSPAPVSTMPKRMSSEGPPRMSPKAQRHPRNHRVSAGRGSISSGLEFVSHNPPSEAAT
PPVARTSPSGGTWSSVVSGVPRLSPKTHRPRSPRQNSIGNTPSGPVLASPQAGIIPTEAV
AMPIPAASPTPASPASNRAVTPSSEAKDSRLQDQRQNSPAGNKENIKPNETSPSFSKAEN
KGISPVVSEHRKQIDDLKKFKNDFRLQPSSTSESMDQLLNKNREGEKSRDLIKDKIEPSA
KDSFIENSSSNCTSGSSKPNSPSISPSILSNTEHKRGPEVTSQGVQTSSPACKQEKDDKE
EKKDAAEQVRKSTLNPNAKEFNPRSFSQPKPSTTPTSPRPQAQPSPSMVGHQQPTPVYTQ
PVCFAPNMMYPVPVSPGVQPLYPIPMTPMPVNQAKTYRAVPNMPQQRQDQHHQSAMMHPA
SAAGPPIAATPPAYSTQYVAYSPQQFPNQPLVQHVPHYQSQHPHVYSPVIQGNARMMAPP
THAQPGLVSSSATQYGAHEQTHAMYACPKLPYNKETSPSFYFAISTGSLAQQYAHPNATL
HPHTPHPQPSATPTGQQQSQHGGSHPAPSPVQHHQHQAAQALHLASPQQQSAIYHAGLAP
TPPSMTPASNTQSPQNSFPAAQQTVFTIHPSHVQPAYTNPPHMAHVPQAHVQSGMVPSHP
TAHAPMMLMTTQPPGGPQAALAQSALQPIPVSTTAHFPYMTHPSVQAHHQQQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A5F9ZHH4	0.153	0.181	0.000	1065	0.810	0.998	A0A5F9ZHH4.pdb.gz	A0A5F9ZHH4_HUMAN Ataxin 2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=1
2	AFDB:F8WB06	0.148	0.169	0.000	1087	0.827	0.999	F8WB06.pdb.gz	F8WB06_HUMAN Ataxin 2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=3
3	AFDB:O70305	0.294	0.298	0.000	1285	0.880	0.899	O70305.pdb.gz	ATX2_MOUSE Ataxin-2 OS=Mus musculus OX=10090 GN=Atxn2 PE=1 SV=1
4	AFDB:Q99700	0.999	0.999	0.000	1313	1.000	1.000	Q99700.pdb.gz	ATX2_HUMAN Ataxin-2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=2
5	AFDB:Q8WWM7	0.172	0.201	2.133E-53	1075	0.334	0.408	Q8WWM7.pdb.gz	ATX2L_HUMAN Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2
6	AFDB:Q8SWR8	0.117	0.134	8.273E-28	1084	0.196	0.237	Q8SWR8.pdb.gz	ATX2_DROME Ataxin-2 homolog OS=Drosophila melanogaster OX=7227 GN=Atx2 PE=1 SV=1
7	PDB:3jcmh	0.050	0.740	3.537E-6	77	0.012	0.208	3jcmh.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
8	PDB:6v4xG	0.049	0.748	4.860E-6	77	0.009	0.156	6v4xG.pdb.gz	Structure of an active human histone pre-mRNA 3'-end processing machinery.
9	AFDB:O13736	0.035	0.033	6.418E-6	1420	0.167	0.154	O13736.pdb.gz	SLA1_SCHPO Actin cytoskeleton-regulatory complex protein sla1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sla1 PE=1 SV=1
10	PDB:7b9vq	0.048	0.744	8.081E-6	75	0.011	0.200	7b9vq.pdb.gz	Structural basis for conformational equilibrium of the catalytic spliceosome.
11	PDB:5nrll	0.053	0.592	8.611E-6	99	0.008	0.111	5nrll.pdb.gz	Structure of a pre-catalytic spliceosome.
12	PDB:3pgwF	0.050	0.685	9.177E-6	85	0.012	0.188	3pgwF.pdb.gz
13	PDB:3pgwQ	0.048	0.735	9.779E-6	76	0.010	0.171	3pgwQ.pdb.gz
14	PDB:6exnr	0.051	0.765	1.432E-5	75	0.008	0.147	6exnr.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
15	PDB:6qw666	0.051	0.797	1.432E-5	72	0.007	0.125	6qw666.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
16	PDB:5vsuF	0.055	0.763	1.733E-5	77	0.008	0.143	5vsuF.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
17	PDB:3jb9J	0.050	0.781	1.968E-5	73	0.010	0.178	3jb9J.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
18	AFDB:Q7TPM1	0.043	0.039	7.183E-5	1486	0.187	0.165	Q7TPM1.pdb.gz	PRC2B_MOUSE Protein PRRC2B OS=Mus musculus OX=10090 GN=Prrc2b PE=1 SV=1
19	AFDB:Q1G7G9	0.036	0.034	7.655E-5	1523	0.169	0.146	Q1G7G9.pdb.gz	TALD3_CHICK TALPID3 protein OS=Gallus gallus OX=9031 GN=TALPID3 PE=2 SV=2
20	AFDB:F1QAC4	0.039	0.037	3.519E-4	1404	0.152	0.142	F1QAC4.pdb.gz	F1QAC4_DANRE GLI family zinc finger 1 OS=Danio rerio OX=7955 GN=gli1 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y5A6	0.0	2320	1166	0.878	0.989	A0A2R8Y5A6_HUMAN Ataxin 2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=1
2	A0A5F9ZHH4	0.0	1515	1065	0.710	0.875	A0A5F9ZHH4_HUMAN Ataxin 2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=1
3	A0A5F9ZHW5	0.0	2314	1178	0.878	0.979	A0A5F9ZHW5_HUMAN Ataxin 2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=1
4	A0A5F9ZHX3	0.0	2316	1167	0.878	0.988	A0A5F9ZHX3_HUMAN Ataxin 2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=1
5	A0A5F9ZI57	0.0	2326	1155	0.878	0.998	A0A5F9ZI57_HUMAN Ataxin 2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=1
6	F8VQP2	0.0	2116	1073	0.798	0.977	F8VQP2_HUMAN Ataxin 2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=1
7	F8W0B5	0.0	1522	908	0.655	0.947	F8W0B5_HUMAN Ataxin 2 (Fragment) OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=4
8	F8WB05	0.0	703	424	0.295	0.913	F8WB05_HUMAN Ataxin 2 (Fragment) OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=2
9	F8WB06	0.0	2038	1087	0.792	0.957	F8WB06_HUMAN Ataxin 2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=3
10	O70305	0.0	2018	1285	0.874	0.893	ATX2_MOUSE Ataxin-2 OS=Mus musculus OX=10090 GN=Atxn2 PE=1 SV=1
11	Q99700	0.0	2645	1313	1.000	1.000	ATX2_HUMAN Ataxin-2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=2
12	V9GY86	0.0	2330	1153	0.878	1.000	V9GY86_HUMAN Ataxin 2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=1
13	A0A2R8YCG6	4.62e-155	469	298	0.206	0.909	A0A2R8YCG6_HUMAN Ataxin 2 (Fragment) OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=1
14	Q8WWM7	8.03e-148	478	1075	0.321	0.392	ATX2L_HUMAN Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2
15	H3BUF6	8.90e-147	474	1068	0.320	0.393	H3BUF6_HUMAN Ataxin 2 like OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=1
16	A0A2R8YGV1	5.50e-138	423	255	0.184	0.949	A0A2R8YGV1_HUMAN Ataxin 2 (Fragment) OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=1
17	Q8SWR8	1.46e-44	178	1084	0.076	0.092	ATX2_DROME Ataxin-2 homolog OS=Drosophila melanogaster OX=7227 GN=Atx2 PE=1 SV=1
18	A0A0C4DGL7	1.61e-31	130	401	0.117	0.382	A0A0C4DGL7_HUMAN Ataxin 2 like (Fragment) OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=1
19	G5ED29	2.12e-12	74.3	959	0.046	0.063	ATX2_CAEEL Ataxin-2 homolog OS=Caenorhabditis elegans OX=6239 GN=atx-2 PE=1 SV=1
20	D4PH96	7.00e-12	72.8	1070	0.046	0.056	D4PH96_CAEEL LsmAD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=atx-2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01423 LSM	22	16.1	LSM domain
2	PF06741 LsmAD	3.9e-12	57.9	LsmAD domain
3	PF07145 PAM2	0.011	26.5	Ataxin-2 C-terminal region
4	PF14438 SM-ATX	1.6e-17	74.8	Ataxin 2 SM domain
5	PF03153 TFIIA	2.7	19.5	Transcription factor IIA, alpha/beta subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366843

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000313007	0.999	Polyadenylate-binding protein 1
2	9606.ENSP00000306253	0.993	Inositol 1,4,5-trisphosphate receptor type 1
3	9606.ENSP00000309117	0.993	RNA binding protein fox-1 homolog 1
4	9606.ENSP00000478754	0.993	Probable ATP-dependent RNA helicase DDX6
5	9606.ENSP00000466718	0.986	LSM12 homolog
6	9606.ENSP00000478320	0.972	Ataxin-3
7	9606.ENSP00000369981	0.966	Endophilin-A1
8	9606.ENSP00000240185	0.945	TAR DNA-binding protein 43
9	9606.ENSP00000361949	0.941	Polyadenylate-binding protein 4
10	9606.ENSP00000254108	0.936	RNA-binding protein FUS
11	9606.ENSP00000378917	0.910	Ataxin-2-like protein
12	9606.ENSP00000377681	0.902	Ras GTPase-activating protein-binding protein 1
13	9606.ENSP00000369996	0.880	Ataxin-3-like protein
14	9606.ENSP00000362300	0.873	Protein argonaute-1
15	9606.ENSP00000244769	0.869	Ataxin-1
16	9606.ENSP00000359506	0.828	Synaptic functional regulator FMR1
17	9606.ENSP00000224140	0.809	Probable helicase senataxin
18	9606.ENSP00000482753	0.806	Guanine nucleotide exchange C9orf72
19	9606.ENSP00000401371	0.804	Nucleolysin TIA-1 isoform p40
20	9606.ENSP00000320092	0.796	Endophilin-A3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005154	1.000	epidermal growth factor receptor binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0009987	0.998	cellular process
GO:0050789	0.994	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0071840	0.975	cellular component organization or biogenesis
GO:0016043	0.974	cellular component organization
GO:0048519	0.967	negative regulation of biological process
GO:0048523	0.912	negative regulation of cellular process
GO:0051128	0.731	regulation of cellular component organization
GO:0022607	0.604	cellular component assembly
GO:0006996	0.587	organelle organization
GO:0071704	0.413	organic substance metabolic process
GO:0019222	0.385	regulation of metabolic process
GO:0048518	0.384	positive regulation of biological process
GO:0044238	0.377	primary metabolic process
GO:0044237	0.371	cellular metabolic process
GO:0006807	0.364	nitrogen compound metabolic process
GO:0043170	0.358	macromolecule metabolic process
GO:0060255	0.318	regulation of macromolecule metabolic process
GO:0031323	0.306	regulation of cellular metabolic process
GO:0051171	0.303	regulation of nitrogen compound metabolic process
GO:0080090	0.302	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0043231	0.945	intracellular membrane-bounded organelle
GO:0005634	0.861	nucleus
GO:0032991	0.824	protein-containing complex
GO:0070013	0.807	intracellular organelle lumen
GO:0048471	0.776	perinuclear region of cytoplasm
GO:0016020	0.731	membrane
GO:0043232	0.731	intracellular non-membrane-bounded organelle
GO:0036464	0.721	cytoplasmic ribonucleoprotein granule
GO:0012505	0.524	endomembrane system
GO:0031981	0.412	nuclear lumen
GO:1990904	0.409	ribonucleoprotein complex
GO:0010494	0.382	cytoplasmic stress granule
GO:0005844	0.310	polysome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]