StarFunc result for job id Q99706

User Input

>input (377 residues)
MSMSPTVIILACLGFFLDQSVWAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIF
TLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVT
GLYEKPSLTARPGPTVRAGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQA
DFPLGPATHGETYRCFGSFHGSPYEWSDPSDPLPVSVTGNPSSSWPSPTEPSFKTGIARH
LHAVIRYSVAIILFTILPFFLLHRWCSKKKDAAVMNQEPAGHRTVNREDSDEQDPQEVTY
AQLDHCIFTQRKITGPSQRSKRPSTDTSVCIELPNAEPRALSPAHEHHSQALMGSSRETT
ALSQTQLASSNVPAAGI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99706	1.000	1.000	2.841E-68	377	1.000	1.000	Q99706.pdb.gz	KI2L4_HUMAN Killer cell immunoglobulin-like receptor 2DL4 OS=Homo sapiens OX=9606 GN=KIR2DL4 PE=1 SV=3
2	AFDB:P43630	0.276	0.229	6.110E-45	455	0.679	0.563	P43630.pdb.gz	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
3	AFDB:P43629	0.374	0.326	4.163E-44	444	0.663	0.563	P43629.pdb.gz	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
4	AFDB:P43626	0.496	0.534	2.541E-41	348	0.584	0.632	P43626.pdb.gz	KI2L1_HUMAN Killer cell immunoglobulin-like receptor 2DL1 OS=Homo sapiens OX=9606 GN=KIR2DL1 PE=1 SV=1
5	AFDB:Q8N743	0.264	0.243	1.316E-40	410	0.597	0.549	Q8N743.pdb.gz	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
6	AFDB:P43632	0.494	0.607	1.551E-37	304	0.515	0.638	P43632.pdb.gz	KI2S4_HUMAN Killer cell immunoglobulin-like receptor 2DS4 OS=Homo sapiens OX=9606 GN=KIR2DS4 PE=1 SV=2
7	AFDB:Q14952	0.491	0.605	1.245E-36	304	0.493	0.612	Q14952.pdb.gz	KI2S3_HUMAN Killer cell immunoglobulin-like receptor 2DS3 OS=Homo sapiens OX=9606 GN=KIR2DS3 PE=2 SV=1
8	AFDB:O75022	0.464	0.288	3.725E-25	631	0.318	0.190	O75022.pdb.gz	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
9	AFDB:Q8NHL6	0.462	0.274	4.639E-24	650	0.324	0.188	Q8NHL6.pdb.gz	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
10	AFDB:Q8N423	0.470	0.306	4.900E-24	598	0.302	0.191	Q8N423.pdb.gz	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
11	PDB:5c6wJ	0.223	0.320	2.509E-7	238	0.066	0.105	5c6wJ.pdb.gz
12	PDB:7u7nC	0.181	0.307	4.110E-6	200	0.080	0.150	7u7nC.pdb.gz
13	PDB:1ngwH	0.209	0.294	1.230E-5	216	0.082	0.144	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
14	PDB:3besR	0.183	0.260	2.375E-5	250	0.042	0.064	3besR.pdb.gz
15	PDB:3bn9F	0.219	0.303	2.650E-5	224	0.077	0.129	3bn9F.pdb.gz
16	PDB:3o3uN	0.195	0.133	4.844E-5	580	0.080	0.052	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
17	PDB:1aqkL	0.202	0.318	5.710E-5	216	0.080	0.139	1aqkL.pdb.gz
18	PDB:6pxvA	0.167	0.090	6.731E-5	823	0.061	0.028	6pxvA.pdb.gz
19	PDB:7czpH	0.231	0.324	7.510E-5	222	0.093	0.158	7czpH.pdb.gz
20	PDB:1seqL	0.206	0.337	8.853E-5	208	0.074	0.135	1seqL.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99706	0.0	781	377	1.000	1.000	KI2L4_HUMAN Killer cell immunoglobulin-like receptor 2DL4 OS=Homo sapiens OX=9606 GN=KIR2DL4 PE=1 SV=3
2	P43626	1.89e-137	397	348	0.576	0.624	KI2L1_HUMAN Killer cell immunoglobulin-like receptor 2DL1 OS=Homo sapiens OX=9606 GN=KIR2DL1 PE=1 SV=1
3	P43628	3.92e-137	396	341	0.570	0.630	KI2L3_HUMAN Killer cell immunoglobulin-like receptor 2DL3 OS=Homo sapiens OX=9606 GN=KIR2DL3 PE=1 SV=1
4	P43627	1.42e-134	390	348	0.568	0.615	KI2L2_HUMAN Killer cell immunoglobulin-like receptor 2DL2 OS=Homo sapiens OX=9606 GN=KIR2DL2 PE=1 SV=1
5	P43630	2.28e-131	385	455	0.557	0.462	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
6	P43632	2.65e-129	375	304	0.515	0.638	KI2S4_HUMAN Killer cell immunoglobulin-like receptor 2DS4 OS=Homo sapiens OX=9606 GN=KIR2DS4 PE=1 SV=2
7	P43629	1.35e-127	375	444	0.552	0.468	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
8	P43631	7.16e-125	363	304	0.507	0.628	KI2S2_HUMAN Killer cell immunoglobulin-like receptor 2DS2 OS=Homo sapiens OX=9606 GN=KIR2DS2 PE=1 SV=2
9	Q14954	5.51e-124	361	304	0.501	0.622	KI2S1_HUMAN Killer cell immunoglobulin-like receptor 2DS1 OS=Homo sapiens OX=9606 GN=KIR2DS1 PE=1 SV=2
10	Q14952	1.15e-120	353	304	0.493	0.612	KI2S3_HUMAN Killer cell immunoglobulin-like receptor 2DS3 OS=Homo sapiens OX=9606 GN=KIR2DS3 PE=2 SV=1
11	Q14953	5.67e-120	351	304	0.491	0.609	KI2S5_HUMAN Killer cell immunoglobulin-like receptor 2DS5 OS=Homo sapiens OX=9606 GN=KIR2DS5 PE=1 SV=2
12	Q8N743	8.17e-118	349	410	0.496	0.456	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
13	F2VZG2	1.21e-107	319	293	0.456	0.587	F2VZG2_PANTR KIR2DS4 OS=Pan troglodytes OX=9598 GN=KIR2DS4 PE=1 SV=1
14	Q14943	1.32e-93	286	382	0.414	0.408	KI3S1_HUMAN Killer cell immunoglobulin-like receptor 3DS1 OS=Homo sapiens OX=9606 GN=KIR3DS1 PE=1 SV=2
15	A6NI73	1.07e-41	150	299	0.273	0.344	LIRA5_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 5 OS=Homo sapiens OX=9606 GN=LILRA5 PE=1 SV=1
16	O75022	1.55e-37	145	631	0.297	0.177	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
17	Q8N149	1.58e-36	140	483	0.220	0.172	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
18	Q8C567	1.12e-35	134	325	0.263	0.305	NCTR1_MOUSE Natural cytotoxicity triggering receptor 1 OS=Mus musculus OX=10090 GN=Ncr1 PE=1 SV=2
19	O75019	5.67e-35	136	489	0.220	0.170	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
20	O76036	2.11e-34	130	304	0.255	0.316	NCTR1_HUMAN Natural cytotoxicity triggering receptor 1 OS=Homo sapiens OX=9606 GN=NCR1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00047 ig	1.7e-21	87.5	Immunoglobulin domain
2	PF13895 Ig_2	1.6e-10	52.4	Immunoglobulin domain
3	PF13927 Ig_3	7.3e-07	41.0	Immunoglobulin domain
4	PF07686 V-set	0.025	26.2	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000019717

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000057110	0.930	Natural killer cells antigen CD94
2	9598.ENSPTRP00000054601	0.914	Patr class I histocompatibility antigen, alpha chain E
3	9598.ENSPTRP00000054743	0.910	NKG2-A/NKG2-B type II integral membrane protein
4	9598.ENSPTRP00000061016	0.908	Patr class I histocompatibility antigen, A-5 alpha chain
5	9598.ENSPTRP00000007993	0.901	Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells
6	9598.ENSPTRP00000055109	0.886	Uncharacterized protein
7	9598.ENSPTRP00000030551	0.884	Uncharacterized protein
8	9598.ENSPTRP00000056399	0.884	Involved in the presentation of foreign antigens to the immune system
9	9598.ENSPTRP00000054564	0.878	Belongs to the MHC class I family.
10	9598.ENSPTRP00000055213	0.842	May play a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells
11	9598.ENSPTRP00000054284	0.827	Pan troglodytes killer cell immunoglobulin-like receptor, three domains, X1 (KIR3DX1), mRNA
12	9598.ENSPTRP00000007991	0.815	Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells
13	9598.ENSPTRP00000058951	0.810	Uncharacterized protein
14	9598.ENSPTRP00000048489	0.800	Uncharacterized protein
15	9598.ENSPTRP00000018632	0.719	TYRO protein tyrosine kinase-binding protein
16	9598.ENSPTRP00000011997	0.622	Beta-2-microglobulin
17	9598.ENSPTRP00000050501	0.620	Protein tyrosine phosphatase, non-receptor type 6
18	9598.ENSPTRP00000025420	0.545	Uncharacterized protein
19	9598.ENSPTRP00000018631	0.527	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.995	signaling receptor activity
GO:0004888	0.922	transmembrane signaling receptor activity
GO:0140375	0.541	immune receptor activity
GO:0005102	0.381	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.991	response to stimulus
GO:0050794	0.991	regulation of cellular process
GO:0002682	0.985	regulation of immune system process
GO:0009987	0.982	cellular process
GO:0050776	0.955	regulation of immune response
GO:0051716	0.938	cellular response to stimulus
GO:0023052	0.936	signaling
GO:0002683	0.935	negative regulation of immune system process
GO:0007165	0.927	signal transduction
GO:0048523	0.911	negative regulation of cellular process
GO:0002706	0.907	regulation of lymphocyte mediated immunity
GO:0031341	0.898	regulation of cell killing
GO:0006950	0.892	response to stress
GO:0006952	0.884	defense response
GO:0050778	0.880	positive regulation of immune response
GO:0045088	0.869	regulation of innate immune response
GO:0045089	0.861	positive regulation of innate immune response
GO:0050777	0.857	negative regulation of immune response
GO:0001817	0.856	regulation of cytokine production
GO:0042269	0.855	regulation of natural killer cell mediated cytotoxicity
GO:0032102	0.849	negative regulation of response to external stimulus
GO:0002698	0.844	negative regulation of immune effector process
GO:0031348	0.840	negative regulation of defense response
GO:0051240	0.773	positive regulation of multicellular organismal process
GO:0006968	0.765	cellular defense response
GO:0002699	0.754	positive regulation of immune effector process
GO:0002376	0.751	immune system process
GO:0048522	0.746	positive regulation of cellular process
GO:0001911	0.737	negative regulation of leukocyte mediated cytotoxicity
GO:0002707	0.735	negative regulation of lymphocyte mediated immunity
GO:0009893	0.710	positive regulation of metabolic process
GO:0031323	0.690	regulation of cellular metabolic process
GO:0002700	0.585	regulation of production of molecular mediator of immune response
GO:0010628	0.563	positive regulation of gene expression
GO:0002705	0.556	positive regulation of leukocyte mediated immunity
GO:0006955	0.470	immune response
GO:0007166	0.451	cell surface receptor signaling pathway
GO:0050865	0.388	regulation of cell activation
GO:0002708	0.387	positive regulation of lymphocyte mediated immunity
GO:0032501	0.376	multicellular organismal process
GO:0001819	0.371	positive regulation of cytokine production
GO:0002832	0.310	negative regulation of response to biotic stimulus
GO:0002694	0.307	regulation of leukocyte activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.572	organelle
GO:0005622	0.429	intracellular anatomical structure
GO:0043227	0.427	membrane-bounded organelle
GO:0043229	0.369	intracellular organelle
GO:0043231	0.323	intracellular membrane-bounded organelle
GO:0012505	0.308	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]