StarFunc result for job id Q99707

User Input

>input (1265 residues)
MSPALQDLSQPEGLKKTLRDEINAILQKRIMVLDGGMGTMIQREKLNEEHFRGQEFKDHA
RPLKGNNDILSITQPDVIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLAYRMNMC
SAGVARKAAEEVTLQTGIKRFVAGALGPTNKTLSVSPSVERPDYRNITFDELVEAYQEQA
KGLLDGGVDILLIETIFDTANAKAALFALQNLFEEKYAPRPIFISGTIVDKSGRTLSGQT
GEGFVISVSHGEPLCIGLNCALGAAEMRPFIEIIGKCTTAYVLCYPNAGLPNTFGDYDET
PSMMAKHLKDFAMDGLVNIVGGCCGSTPDHIREIAEAVKNCKPRVPPATAFEGHMLLSGL
EPFRIGPYTNFVNIGERCNVAGSRKFAKLIMAGNYEEALCVAKVQVEMGAQVLDVNMDDG
MLDGPSAMTRFCNLIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEDD
FLEKARKIKKYGAAMVVMAFDEEGQATETDTKIRVCTRAYHLLVKKLGFNPNDIIFDPNI
LTIGTGMEEHNLYAINFIHATKVIKETLPGARISGGLSNLSFSFRGMEAIREAMHGVFLY
HAIKSGMDMGIVNAGNLPVYDDIHKELLQLCEDLIWNKDPEATEKLLRYAQTQGTGGKKV
IQTDEWRNGPVEERLEYALVKGIEKHIIEDTEEARLNQKKYPRPLNIIEGPLMNGMKIVG
DLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKEREETRVLNGTVEEEDPYQGTIVLATV
KGDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCDKILKAALDHKADIIGLSGLITPSLDEM
IFVAKEMERLAIRIPLLIGGATTSKTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDEN
LKDEYFEEIMEEYEDIRQDHYESLKERRYLPLSQARKSGFQMDWLSEPHPVKPTFIGTQV
FEDYDLQKLVDYIDWKPFFDVWQLRGKYPNRGFPKIFNDKTVGGEARKVYDDAHNMLNTL
ISQKKLRARGVVGFWPAQSIQDDIHLYAEAAVPQAAEPIATFYGLRQQAEKDSASTEPYY
CLSDFIAPLHSGIRDYLGLFAVACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEE
LHERVRRELWAYCGSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTG
IRLTESLAMAPASAVSGLYFSNLKSKYFAVGKISKDQVEDYALRKNISVAEVEKWLGPIL
GYDTD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13009	0.917	0.944	0.000	1227	0.530	0.547	P13009.pdb.gz	METH_ECOLI Methionine synthase OS=Escherichia coli (strain K12) OX=83333 GN=metH PE=1 SV=5
2	AFDB:Q99707	1.000	1.000	0.000	1265	1.000	1.000	Q99707.pdb.gz	METH_HUMAN Methionine synthase OS=Homo sapiens OX=9606 GN=MTR PE=1 SV=2
3	AFDB:O33259	0.489	0.517	1.480E-84	1192	0.291	0.309	O33259.pdb.gz	METH_MYCTU Methionine synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=metH PE=1 SV=1
4	PDB:5dmlA	0.204	0.817	1.207E-13	292	0.055	0.240	5dmlA.pdb.gz
5	AFDB:Q32LQ4	0.198	0.577	1.490E-13	400	0.057	0.180	Q32LQ4.pdb.gz	BHMT1_DANRE Betaine--homocysteine S-methyltransferase 1 OS=Danio rerio OX=7955 GN=bhmt PE=2 SV=1
6	AFDB:Q9M1W4	0.213	0.744	1.714E-13	333	0.062	0.234	Q9M1W4.pdb.gz	HMT2_ARATH Homocysteine S-methyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=HMT-2 PE=1 SV=1
7	AFDB:A4ZGQ8	0.217	0.776	2.606E-13	326	0.061	0.236	A4ZGQ8.pdb.gz	HMT1_BRAOT Homocysteine S-methyltransferase 1 OS=Brassica oleracea var. italica OX=36774 GN=HMT1 PE=1 SV=1
8	AFDB:Q4VNK0	0.209	0.699	6.930E-13	346	0.059	0.217	Q4VNK0.pdb.gz	SMTA_BRAOT Selenocysteine Se-methyltransferase OS=Brassica oleracea var. italica OX=36774 GN=SMT PE=1 SV=1
9	AFDB:O09171	0.204	0.594	7.970E-13	407	0.054	0.167	O09171.pdb.gz	BHMT1_RAT Betaine--homocysteine S-methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Bhmt PE=1 SV=1
10	PDB:4djdA	0.176	0.802	8.538E-13	262	0.054	0.260	4djdA.pdb.gz	Visualizing molecular juggling within a B12-dependent methyltransferase complex.
11	PDB:5dmnA	0.189	0.835	1.425E-12	263	0.048	0.232	5dmnA.pdb.gz
12	AFDB:Q47690	0.211	0.791	1.460E-12	310	0.054	0.219	Q47690.pdb.gz	MMUM_ECOLI Homocysteine S-methyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=mmuM PE=1 SV=2
13	AFDB:Q46389	0.174	0.791	1.679E-12	262	0.054	0.260	Q46389.pdb.gz	ACSE_MOOTH 5-methyltetrahydrofolate:corrinoid/iron-sulfur protein co-methyltransferase OS=Moorella thermoacetica OX=1525 GN=acsE PE=1 SV=2
14	PDB:2i2xB	0.162	0.710	1.306E-10	258	0.050	0.244	2i2xB.pdb.gz	Insight into the mechanism of biological methanol activation based on the crystal structure of the methanol-cobalamin methyltransferase complex
15	PDB:1umyD	0.201	0.626	1.434E-10	381	0.059	0.197	1umyD.pdb.gz	Crystal structure of rat liver betaine homocysteine s-methyltransferase reveals new oligomerization features and conformational changes upon substrate binding.
16	PDB:1lt7B	0.182	0.661	1.810E-10	315	0.051	0.206	1lt7B.pdb.gz
17	PDB:3ezxA	0.112	0.502	7.716E-8	212	0.049	0.292	3ezxA.pdb.gz	Structure of Methanosarcina barkeri monomethylamine corrinoid protein
18	PDB:1e1cA	0.135	0.208	2.590E-7	727	0.065	0.113	1e1cA.pdb.gz	Protection of Radical Intermediates at the Active Site of Adenosylcobalamin-Dependent Methylmalonyl-Coa Mutase
19	PDB:6oxdA	0.138	0.217	6.889E-7	736	0.068	0.117	6oxdA.pdb.gz	Itaconyl-CoA forms a stable biradical in methylmalonyl-CoA mutase and derails its activity and repair.
20	PDB:3bicA	0.134	0.211	1.098E-6	715	0.064	0.113	3bicA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6H5Y3	0.0	2417	1253	0.911	0.920	METH_MOUSE Methionine synthase OS=Mus musculus OX=10090 GN=Mtr PE=1 SV=1
2	G3V8A4	0.0	2439	1253	0.916	0.925	G3V8A4_RAT Methionine synthase OS=Rattus norvegicus OX=10116 GN=Mtr PE=1 SV=1
3	P13009	0.0	1311	1227	0.535	0.552	METH_ECOLI Methionine synthase OS=Escherichia coli (strain K12) OX=83333 GN=metH PE=1 SV=5
4	Q99707	0.0	2621	1265	1.000	1.000	METH_HUMAN Methionine synthase OS=Homo sapiens OX=9606 GN=MTR PE=1 SV=2
5	Q9Z2Q4	0.0	2437	1253	0.915	0.924	METH_RAT Methionine synthase OS=Rattus norvegicus OX=10116 GN=Mtr PE=1 SV=1
6	O33259	2.12e-152	492	1192	0.308	0.327	METH_MYCTU Methionine synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=metH PE=1 SV=1
7	O30641	1.80e-16	82.0	217	0.039	0.226	MTMC1_METBA Monomethylamine corrinoid protein 1 OS=Methanosarcina barkeri OX=2208 GN=mtmC1 PE=1 SV=3
8	Q9SDL7	2.83e-15	80.9	326	0.069	0.267	HMT1_ARATH Homocysteine S-methyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=HMT-1 PE=1 SV=1
9	A4ZGQ8	6.54e-15	79.7	326	0.065	0.252	HMT1_BRAOT Homocysteine S-methyltransferase 1 OS=Brassica oleracea var. italica OX=36774 GN=HMT1 PE=1 SV=1
10	Q46EH4	6.55e-15	78.6	258	0.045	0.221	MTAC_METBF Methanol--corrinoid protein OS=Methanosarcina barkeri (strain Fusaro / DSM 804) OX=269797 GN=mtaC PE=1 SV=1
11	Q46389	8.72e-14	75.1	262	0.047	0.229	ACSE_MOOTH 5-methyltetrahydrofolate:corrinoid/iron-sulfur protein co-methyltransferase OS=Moorella thermoacetica OX=1525 GN=acsE PE=1 SV=2
12	Q48925	7.67e-13	72.8	275	0.046	0.211	MTSB_METBA Methylated-thiol--corrinoid protein MtsB OS=Methanosarcina barkeri OX=2208 GN=mtsB PE=3 SV=1
13	Q47690	3.81e-11	68.2	310	0.067	0.274	MMUM_ECOLI Homocysteine S-methyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=mmuM PE=1 SV=2
14	Q4VNK0	1.55e-10	66.6	346	0.066	0.240	SMTA_BRAOT Selenocysteine Se-methyltransferase OS=Brassica oleracea var. italica OX=36774 GN=SMT PE=1 SV=1
15	Q9M1W4	2.63e-10	65.9	333	0.062	0.234	HMT2_ARATH Homocysteine S-methyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=HMT-2 PE=1 SV=1
16	O09171	7.67e-09	61.6	407	0.057	0.177	BHMT1_RAT Betaine--homocysteine S-methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Bhmt PE=1 SV=1
17	O35490	1.19e-08	61.2	407	0.056	0.174	BHMT1_MOUSE Betaine--homocysteine S-methyltransferase 1 OS=Mus musculus OX=10090 GN=Bhmt PE=1 SV=1
18	Q12525	2.21e-08	59.7	324	0.058	0.225	MHT1_YEAST Homocysteine S-methyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MHT1 PE=1 SV=1
19	Q93088	2.57e-07	57.0	406	0.055	0.172	BHMT1_HUMAN Betaine--homocysteine S-methyltransferase 1 OS=Homo sapiens OX=9606 GN=BHMT PE=1 SV=2
20	V9HWA4	2.57e-07	57.0	406	0.055	0.172	V9HWA4_HUMAN Betaine-homocysteine methyltransferase, isoform CRA_a OS=Homo sapiens OX=9606 GN=HEL-S-61p PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02310 B12-binding	7.6e-15	66.4	B12 binding domain
2	PF02607 B12-binding_2	5.1e-21	86.2	B12 binding domain
3	PF03599 CdhD	24	15.1	CO dehydrogenase/acetyl-CoA synthase delta subunit
4	PF10816 DUF2760	1.1e+02	14.0	Domain of unknown function (DUF2760)
5	PF01745 IPT	3.5e+02	12.0	Isopentenyl transferase
6	PF02965 Met_synt_B12	3.5e-110	379.3	Vitamin B12 dependent methionine synthase, activation domain
7	PF00809 Pterin_bind	5.9e-57	204.7	Pterin binding enzyme
8	PF02574 S-methyl_trans	2.8e-75	265.3	Homocysteine S-methyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355536

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365777	0.996	Methylenetetrahydrofolate reductase
2	9606.ENSP00000264668	0.992	Methionine synthase reductase
3	9606.ENSP00000381231	0.987	Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L- homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine. Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons.
4	9606.ENSP00000216605	0.984	C-1-tetrahydrofolate synthase, cytoplasmic
5	9606.ENSP00000217426	0.983	Adenosylhomocysteinase
6	9606.ENSP00000318868	0.983	Serine hydroxymethyltransferase, cytosolic
7	9606.ENSP00000359976	0.978	Cystathionine gamma-lyase
8	9606.ENSP00000361287	0.977	S-adenosylmethionine synthase isoform type-1
9	9606.ENSP00000396308	0.977	Dihydrofolate reductase
10	9606.ENSP00000333667	0.972	Serine hydroxymethyltransferase, mitochondrial
11	9606.ENSP00000303147	0.971	S-adenosylmethionine synthase isoform type-2
12	9606.ENSP00000389060	0.965	Methylmalonic aciduria and homocystinuria type D protein, mitochondrial
13	9606.ENSP00000478253	0.965	Monofunctional C1-tetrahydrofolate synthase, mitochondrial
14	9606.ENSP00000236959	0.964	Bifunctional purine biosynthesis protein PURH
15	9606.ENSP00000371253	0.957	Trifunctional purine biosynthetic protein adenosine-3
16	9606.ENSP00000377768	0.952	Dihydrofolate reductase 2, mitochondrial
17	9606.ENSP00000383840	0.951	Methylmalonic aciduria and homocystinuria type C protein
18	9606.ENSP00000325425	0.950	Methionine adenosyltransferase 2 subunit beta
19	9606.ENSP00000262027	0.947	Methionine--tRNA ligase, cytoplasmic
20	9606.ENSP00000273450	0.946	Cytosolic 10-formyltetrahydrofolate dehydrogenase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	1.000	binding
GO:0008705	1.000	methionine synthase activity
GO:0005515	0.987	protein binding
GO:0043167	0.862	ion binding
GO:0036094	0.785	small molecule binding
GO:1901363	0.627	heterocyclic compound binding
GO:0097159	0.607	organic cyclic compound binding
GO:0019842	0.447	vitamin binding
GO:0046906	0.387	tetrapyrrole binding
GO:0031419	0.343	cobalamin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044281	0.994	small molecule metabolic process
GO:0044238	0.988	primary metabolic process
GO:1901564	0.978	organonitrogen compound metabolic process
GO:1901360	0.974	organic cyclic compound metabolic process
GO:0006725	0.952	cellular aromatic compound metabolic process
GO:0046483	0.945	heterocycle metabolic process
GO:0006790	0.928	sulfur compound metabolic process
GO:1901605	0.928	alpha-amino acid metabolic process
GO:0000096	0.917	sulfur amino acid metabolic process
GO:0006766	0.914	vitamin metabolic process
GO:0006767	0.882	water-soluble vitamin metabolic process
GO:0009058	0.881	biosynthetic process
GO:1901576	0.871	organic substance biosynthetic process
GO:0044249	0.869	cellular biosynthetic process
GO:0044283	0.860	small molecule biosynthetic process
GO:1901566	0.858	organonitrogen compound biosynthetic process
GO:0033013	0.853	tetrapyrrole metabolic process
GO:0044272	0.789	sulfur compound biosynthetic process
GO:0009066	0.769	aspartate family amino acid metabolic process
GO:0009067	0.720	aspartate family amino acid biosynthetic process
GO:0006555	0.718	methionine metabolic process
GO:0000097	0.705	sulfur amino acid biosynthetic process
GO:0009086	0.697	methionine biosynthetic process
GO:0034641	0.353	cellular nitrogen compound metabolic process
GO:0032501	0.325	multicellular organismal process
GO:0032502	0.301	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.840	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11172	1.000	(6S)-5-methyl-5,6,7,8-tetrahydrofolate + L-homocysteine = (6S)-5,6,7,8-tetrahydrofolate + L-methionine
EC:2.1.1.13	1.000	methionine synthase.

[back to server]