StarFunc result for job id Q99708

User Input

>input (897 residues)
MNISGSSCGSPNSADTSSDFKDLWTKLKECHDREVQGLQVKVTKLKQERILDAQRLEEFF
TKNQQLREQQKVLHETIKVLEDRLRAGLCDRCAVTEEHMRKKQQEFENIRQQNLKLITEL
MNERNTLQEENKKLSEQLQQKIENDQQHQAAELECEEDVIPDSPITAFSFSGVNRLRRKE
NPHVRYIEQTHTKLEHSVCANEMRKVSKSSTHPQHNPNENEILVADTYDQSQSPMAKAHG
TSSYTPDKSSFNLATVVAETLGLGVQEESETQGPMSPLGDELYHCLEGNHKKQPFEESTR
NTEDSLRFSDSTSKTPPQEELPTRVSSPVFGATSSIKSGLDLNTSLSPSLLQPGKKKHLK
TLPFSNTCISRLEKTRSKSEDSALFTHHSLGSEVNKIIIQSSNKQILINKNISESLGEQN
RTEYGKDSNTDKHLEPLKSLGGRTSKRKKTEEESEHEVSCPQASFDKENAFPFPMDNQFS
MNGDCVMDKPLDLSDRFSAIQRQEKSQGSETSKNKFRQVTLYEALKTIPKGFSSSRKASD
GNCTLPKDSPGEPCSQECIILQPLNKCSPDNKPSLQIKEENAVFKIPLRPRESLETENVL
DDIKSAGSHEPIKIQTRSDHGGCELASVLQLNPCRTGKIKSLQNNQDVSFENIQWSIDPG
ADLSQYKMDVTVIDTKDGSQSKLGGETVDMDCTLVSETVLLKMKKQEQKGEKSSNEERKM
NDSLEDMFDRTTHEEYESCLADSFSQAADEEEELSTATKKLHTHGDKQDKVKQKAFVEPY
FKGDERETSLQNFPHIEVVRKKEERRKLLGHTCKECEIYYADMPAEEREKKLASCSRHRF
RYIPPNTPENFWEVGFPSTQTCMERGYIKEDLDPCPRPKRRQPYNAIFSPKGKEQKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:I6L8A6	0.126	0.126	0.000	902	0.999	0.993	I6L8A6.pdb.gz	I6L8A6_HUMAN DNA endonuclease RBBP8 OS=Homo sapiens OX=9606 GN=RBBP8 PE=1 SV=1
2	AFDB:Q80YR6	0.169	0.170	4.340E-86	893	0.760	0.764	Q80YR6.pdb.gz	CTIP_MOUSE DNA endonuclease RBBP8 OS=Mus musculus OX=10090 GN=Rbbp8 PE=1 SV=1
3	AFDB:B1WC58	0.183	0.183	2.223E-85	893	0.750	0.754	B1WC58.pdb.gz	CTIP_RAT DNA endonuclease RBBP8 OS=Rattus norvegicus OX=10116 GN=Rbbp8 PE=2 SV=1
4	AFDB:Q6GNV6	0.159	0.165	2.183E-43	856	0.457	0.479	Q6GNV6.pdb.gz	CTIP_XENLA DNA endonuclease RBBP8 OS=Xenopus laevis OX=8355 GN=rbbp8 PE=1 SV=1
5	AFDB:Q8NC74	0.103	0.135	4.842E-7	664	0.182	0.245	Q8NC74.pdb.gz	RB8NL_HUMAN RBBP8 N-terminal-like protein OS=Homo sapiens OX=9606 GN=RBBP8NL PE=1 SV=3
6	AFDB:Q9Y2F5	0.079	0.039	3.922E-2	2266	0.163	0.064	Q9Y2F5.pdb.gz	ICE1_HUMAN Little elongation complex subunit 1 OS=Homo sapiens OX=9606 GN=ICE1 PE=1 SV=5
7	AFDB:A0A2R8QCI3	0.095	0.048	5.805E-2	2023	0.126	0.056	A0A2R8QCI3.pdb.gz	DAPLE_DANRE Protein Daple OS=Danio rerio OX=7955 GN=ccdc88c PE=2 SV=1
8	AFDB:D4A6A8	0.077	0.067	7.061E-2	1042	0.125	0.107	D4A6A8.pdb.gz	D4A6A8_RAT Protein phosphatase 1, regulatory subunit 13B OS=Rattus norvegicus OX=10116 GN=Ppp1r13b PE=1 SV=1
9	AFDB:F1M5H6	0.081	0.066	8.047E-2	1128	0.134	0.106	F1M5H6.pdb.gz	F1M5H6_RAT Tumor protein p53 binding protein, 2 OS=Rattus norvegicus OX=10116 GN=Tp53bp2 PE=1 SV=2
10	AFDB:Q54WH7	0.081	0.093	1.045E-1	759	0.106	0.125	Q54WH7.pdb.gz	Y5961_DICDI Putative uncharacterized protein DDB_G0279653 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279653 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1WC58	0.0	1349	893	0.754	0.757	CTIP_RAT DNA endonuclease RBBP8 OS=Rattus norvegicus OX=10116 GN=Rbbp8 PE=2 SV=1
2	F6Q6H0	0.0	1189	580	0.647	1.000	F6Q6H0_HUMAN RB binding protein 8, endonuclease (Fragment) OS=Homo sapiens OX=9606 GN=RBBP8 PE=1 SV=1
3	I6L8A6	0.0	1847	902	0.999	0.993	I6L8A6_HUMAN DNA endonuclease RBBP8 OS=Homo sapiens OX=9606 GN=RBBP8 PE=1 SV=1
4	Q6GNV6	0.0	628	856	0.468	0.491	CTIP_XENLA DNA endonuclease RBBP8 OS=Xenopus laevis OX=8355 GN=rbbp8 PE=1 SV=1
5	Q80YR6	0.0	1364	893	0.764	0.767	CTIP_MOUSE DNA endonuclease RBBP8 OS=Mus musculus OX=10090 GN=Rbbp8 PE=1 SV=1
6	Q99708	0.0	1856	897	1.000	1.000	CTIP_HUMAN DNA endonuclease RBBP8 OS=Homo sapiens OX=9606 GN=RBBP8 PE=1 SV=2
7	Q8NC74	1.93e-33	140	664	0.077	0.104	RB8NL_HUMAN RBBP8 N-terminal-like protein OS=Homo sapiens OX=9606 GN=RBBP8NL PE=1 SV=3
8	Q9ZRT1	2.01e-12	73.2	588	0.042	0.065	GR1_ARATH Protein gamma response 1 OS=Arabidopsis thaliana OX=3702 GN=GR1 PE=1 SV=2
9	Q08581	0.65	36.2	821	0.038	0.041	SLK19_YEAST Kinetochore protein SLK19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLK19 PE=1 SV=1
10	Q3TVA9	0.89	35.8	1136	0.046	0.036	CC136_MOUSE Coiled-coil domain-containing protein 136 OS=Mus musculus OX=10090 GN=Ccdc136 PE=1 SV=2
11	Q5XI63	3.2	33.9	693	0.035	0.045	KIFC1_RAT Kinesin-like protein KIFC1 OS=Rattus norvegicus OX=10116 GN=Kifc1 PE=2 SV=1
12	Q66GR0	3.4	33.5	458	0.020	0.039	FLA17_ARATH Fasciclin-like arabinogalactan protein 17 OS=Arabidopsis thaliana OX=3702 GN=FLA17 PE=2 SV=1
13	Q96JN2	3.8	33.9	1154	0.043	0.034	CC136_HUMAN Coiled-coil domain-containing protein 136 OS=Homo sapiens OX=9606 GN=CCDC136 PE=1 SV=3
14	Q57YC6	4.7	33.5	5290	0.032	0.005	Q57YC6_TRYB2 Dynein heavy chain, cytosolic, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.13M20.140 PE=4 SV=1
15	Q9QWT9	5.3	33.1	674	0.036	0.047	KIFC1_MOUSE Kinesin-like protein KIFC1 OS=Mus musculus OX=10090 GN=Kifc1 PE=1 SV=2
16	A0A286YBE9	7.1	33.1	4773	0.029	0.005	A0A286YBE9_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
17	E7F8G7	7.2	33.1	4762	0.029	0.005	E7F8G7_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
18	Q5VU43	7.6	32.7	2346	0.046	0.017	MYOME_HUMAN Myomegalin OS=Homo sapiens OX=9606 GN=PDE4DIP PE=1 SV=3
19	A0A2R8RIJ1	7.7	32.7	4599	0.029	0.006	A0A2R8RIJ1_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
20	A5WV02	7.9	32.7	4577	0.029	0.006	A5WV02_DANRE Plectin OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10482 CtIP_N	4.9e-49	176.7	Tumour-suppressor protein CtIP N-terminal domain
2	PF08573 SAE2	0.00013	34.4	DNA endonuclease activator SAE2/CtIP C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382628

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000290921	0.999	C-terminal-binding protein 1
2	9606.ENSP00000418960	0.999	Breast cancer type 1 susceptibility protein
3	9606.ENSP00000260947	0.998	BRCA1-associated RING domain protein 1
4	9606.ENSP00000265433	0.997	Nibrin
5	9606.ENSP00000278616	0.997	Serine-protein kinase ATM
6	9606.ENSP00000287647	0.994	Fanconi anemia group D2 protein
7	9606.ENSP00000325863	0.994	Double-strand break repair protein MRE11
8	9606.ENSP00000355506	0.994	Exonuclease 1
9	9606.ENSP00000371475	0.986	TP53-binding protein 1
10	9606.ENSP00000370109	0.983	PC4 and SFRS1-interacting protein
11	9606.ENSP00000368100	0.977	DNA repair protein RAD50
12	9606.ENSP00000369497	0.976	Breast cancer type 2 susceptibility protein
13	9606.ENSP00000360310	0.974	Meiotic recombination protein SPO11
14	9606.ENSP00000365588	0.970	Mediator of DNA damage checkpoint protein 1
15	9606.ENSP00000351185	0.969	DNA replication ATP-dependent helicase/nuclease DNA2
16	9606.ENSP00000434024	0.969	Histone H2AX
17	9606.ENSP00000362578	0.968	E3 ubiquitin-protein ligase RNF8
18	9606.ENSP00000265560	0.966	Ubiquitin carboxyl-terminal hydrolase 4
19	9606.ENSP00000243644	0.962	Zinc finger protein 350
20	9606.ENSP00000343741	0.961	Serine/threonine-protein kinase ATR

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.759	organic cyclic compound binding
GO:1901363	0.758	heterocyclic compound binding
GO:0003824	0.619	catalytic activity
GO:0003676	0.612	nucleic acid binding
GO:0003677	0.480	DNA binding
GO:0016787	0.332	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0009987	0.997	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0019222	0.991	regulation of metabolic process
GO:0006725	0.991	cellular aromatic compound metabolic process
GO:0044238	0.990	primary metabolic process
GO:0006974	0.990	cellular response to DNA damage stimulus
GO:0006807	0.988	nitrogen compound metabolic process
GO:0043170	0.985	macromolecule metabolic process
GO:0090304	0.982	nucleic acid metabolic process
GO:0031323	0.979	regulation of cellular metabolic process
GO:0080090	0.977	regulation of primary metabolic process
GO:0051171	0.977	regulation of nitrogen compound metabolic process
GO:0048518	0.975	positive regulation of biological process
GO:0060255	0.970	regulation of macromolecule metabolic process
GO:0006259	0.968	DNA metabolic process
GO:0048522	0.967	positive regulation of cellular process
GO:0045935	0.961	positive regulation of nucleobase-containing compound metabolic process
GO:0006281	0.960	DNA repair
GO:0051052	0.956	regulation of DNA metabolic process
GO:0051054	0.944	positive regulation of DNA metabolic process
GO:2001020	0.916	regulation of response to DNA damage stimulus
GO:0007049	0.887	cell cycle
GO:0022402	0.859	cell cycle process
GO:0006282	0.854	regulation of DNA repair
GO:0000278	0.790	mitotic cell cycle
GO:1903047	0.782	mitotic cell cycle process
GO:0006302	0.732	double-strand break repair
GO:0048519	0.513	negative regulation of biological process
GO:0000018	0.489	regulation of DNA recombination
GO:0048523	0.482	negative regulation of cellular process
GO:0031326	0.480	regulation of cellular biosynthetic process
GO:0045739	0.476	positive regulation of DNA repair
GO:0010556	0.474	regulation of macromolecule biosynthetic process
GO:2000779	0.453	regulation of double-strand break repair
GO:0010468	0.433	regulation of gene expression
GO:0006355	0.408	regulation of DNA-templated transcription
GO:0032501	0.328	multicellular organismal process
GO:0045911	0.323	positive regulation of DNA recombination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.947	protein-containing complex
GO:0043232	0.544	intracellular non-membrane-bounded organelle
GO:0005737	0.485	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.332	Hydrolases.

[back to server]