StarFunc result for job id Q99715

User Input

>input (1400 residues)
MRSRLPPALAALGAALLLSSIEAEVDPPSDLNFKIIDENTVHMSWAKPVDPIVGYRITVD
PTTDGPTKEFTLSASTTETLLSELVPETEYVVTITSYDEVEESVPVIGQLTIQTGSSTKP
VEKKPGKTEIQKCSVSAWTDLVFLVDGSWSVGRNNFKYILDFIAALVSAFDIGEEKTRVG
VVQYSSDTRTEFNLNQYYQRDELLAAIKKIPYKGGNTMTGDAIDYLVKNTFTESAGARVG
FPKVAIIITDGKSQDEVEIPARELRNVGVEVFSLGIKAADAKELKQIASTPSLNHVFNVA
NFDAIVDIQNEIISQVCSGVDEQLGELVSGEEVVEPPSNLIAMEVSSKYVKLNWNPSPSP
VTGYKVILTPMTAGSRQHALSVGPQTTTLSVRDLSADTEYQISVSAMKGMTSSEPISIME
KTQPMKVQVECSRGVDIKADIVFLVDGSYSIGIANFVKVRAFLEVLVKSFEISPNRVQIS
LVQYSRDPHTEFTLKKFTKVEDIIEAINTFPYRGGSTNTGKAMTYVREKIFVPSKGSRSN
VPKVMILITDGKSSDAFRDPAIKLRNSDVEIFAVGVKDAVRSELEAIASPPAETHVFTVE
DFDAFQRISFELTQSICLRIEQELAAIKKKAYVPPKDLSFSEVTSYGFKTNWSPAGENVF
SYHITYKEAAGDDEVTVVEPASSTSVVLSSLKPETLYLVNVTAEYEDGFSIPLAGEETTE
EVKGAPRNLKVTDETTDSFKITWTQAPGRVLRYRIIYRPVAGGESREVTTPPNQRRRTLE
NLIPDTKYEVSVIPEYFSGPGTPLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWSGAPGK
VKQYLVTYTPVAGGETQEVTVRGDTTNTVLQGLKEGTQYALSVTALYASGAGDALFGEGT
TLEERGSPQDLVTKDITDTSIGAYWTSAPGMVRGYRVSWKSLYDDVDTGEKNLPEDAIHT
MIENLQPETKYRISVFATYSSGEGEPLTGDATTELSQDSKTLKVDEETENTMRVTWKPAP
GKVVNYRVVYRPHGRGKQMVAKVPPTVTSTVLKRLQPQTTYDITVLPIYKMGEGKLRQGS
GTTASRFKSPRNLKTSDPTMSSFRVTWEPAPGEVKGYKVTFHPTGDDRRLGELVVGPYDN
TVVLEELRAGTTYKVNVFGMFDGGESSPLVGQEMTTLSDTTVMPILSSGMECLTRAEADI
VLLVDGSWSIGRANFRTVRSFISRIVEVFDIGPKRVQIALAQYSGDPRTEWQLNAHRDKK
SLLQAVANLPYKGGNTLTGMALNFIRQQNFRTQAGMRPRARKIGVLITDGKSQDDVEAPS
KKLKDEGVELFAIGIKNADEVELKMIATDPDDTHAYNVADFESLSRIVDDLTINLCNSVK
GPGDLEAPSNLVISERTHRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1R9Y1	0.158	0.130	0.000	1864	0.278	0.209	F1R9Y1.pdb.gz	F1R9Y1_DANRE Collagen alpha-1(XIV) chain isoform X2 OS=Danio rerio OX=7955 GN=col14a1a PE=1 SV=1
2	AFDB:Q05707	0.143	0.123	0.000	1796	0.277	0.216	Q05707.pdb.gz	COEA1_HUMAN Collagen alpha-1(XIV) chain OS=Homo sapiens OX=9606 GN=COL14A1 PE=1 SV=3
3	AFDB:Q80X19	0.166	0.136	0.000	1797	0.276	0.215	Q80X19.pdb.gz	COEA1_MOUSE Collagen alpha-1(XIV) chain OS=Mus musculus OX=10090 GN=Col14a1 PE=1 SV=2
4	AFDB:Q9P218	0.131	0.143	8.465E-67	1284	0.177	0.193	Q9P218.pdb.gz	COKA1_HUMAN Collagen alpha-1(XX) chain OS=Homo sapiens OX=9606 GN=COL20A1 PE=1 SV=4
5	AFDB:A2CEW3	0.161	0.109	8.947E-61	2500	0.178	0.100	A2CEW3.pdb.gz	A2CEW3_DANRE Fibronectin OS=Danio rerio OX=7955 GN=cb1057 PE=1 SV=2
6	AFDB:P07589	0.169	0.108	1.206E-59	2478	0.173	0.098	P07589.pdb.gz	FINC_BOVIN Fibronectin OS=Bos taurus OX=9913 GN=FN1 PE=1 SV=4
7	AFDB:Q28275	0.116	0.081	9.680E-58	2208	0.166	0.105	Q28275.pdb.gz	FINC_CANLF Fibronectin (Fragment) OS=Canis lupus familiaris OX=9615 GN=FN1 PE=2 SV=3
8	AFDB:P11722	0.138	0.096	8.674E-57	2483	0.180	0.101	P11722.pdb.gz	FINC_CHICK Fibronectin OS=Gallus gallus OX=9031 GN=FN1 PE=2 SV=4
9	AFDB:B0S602	0.150	0.093	9.605E-57	2480	0.172	0.097	B0S602.pdb.gz	B0S602_DANRE Fibronectin OS=Danio rerio OX=7955 GN=Fn PE=1 SV=1
10	AFDB:Q8BYI9	0.139	0.142	7.386E-56	1358	0.125	0.129	Q8BYI9.pdb.gz	TENR_MOUSE Tenascin-R OS=Mus musculus OX=10090 GN=Tnr PE=1 SV=2
11	PDB:4nehA	0.116	0.148	6.402E-19	1084	0.093	0.120	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
12	PDB:4nenA	0.119	0.155	2.177E-18	1063	0.084	0.110	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
13	PDB:5a42A	0.076	0.070	6.481E-14	1597	0.091	0.080	5a42A.pdb.gz
14	PDB:8eyyA	0.137	0.214	9.262E-14	775	0.042	0.076	8eyyA.pdb.gz
15	PDB:7q5zA	0.092	0.096	1.797E-13	1344	0.066	0.068	7q5zA.pdb.gz
16	PDB:4lnvA	0.084	0.090	3.670E-13	1276	0.069	0.076	4lnvA.pdb.gz
17	PDB:5oj2B	0.126	0.218	1.186E-12	692	0.064	0.129	5oj2B.pdb.gz
18	PDB:7q1yA	0.085	0.086	1.382E-12	1374	0.068	0.069	7q1yA.pdb.gz
19	PDB:6h03A	0.095	0.106	4.466E-12	1223	0.054	0.061	6h03A.pdb.gz
20	PDB:6pxvA	0.139	0.210	5.476E-12	823	0.041	0.070	6pxvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q60847	0.0	2603	3120	0.911	0.409	COCA1_MOUSE Collagen alpha-1(XII) chain OS=Mus musculus OX=10090 GN=Col12a1 PE=2 SV=3
2	Q99715	0.0	2833	3063	1.000	0.457	COCA1_HUMAN Collagen alpha-1(XII) chain OS=Homo sapiens OX=9606 GN=COL12A1 PE=1 SV=2
3	Q80X19	1.34e-116	405	1797	0.229	0.178	COEA1_MOUSE Collagen alpha-1(XIV) chain OS=Mus musculus OX=10090 GN=Col14a1 PE=1 SV=2
4	Q05707	1.47e-113	397	1796	0.225	0.175	COEA1_HUMAN Collagen alpha-1(XIV) chain OS=Homo sapiens OX=9606 GN=COL14A1 PE=1 SV=3
5	F1S285	2.68e-110	387	1760	0.206	0.164	F1S285_PIG Collagen type XIV alpha 1 chain OS=Sus scrofa OX=9823 GN=COL14A1 PE=1 SV=3
6	F1R9Y1	9.25e-108	380	1864	0.209	0.157	F1R9Y1_DANRE Collagen alpha-1(XIV) chain isoform X2 OS=Danio rerio OX=7955 GN=col14a1a PE=1 SV=1
7	Q9P218	1.98e-80	293	1284	0.161	0.175	COKA1_HUMAN Collagen alpha-1(XX) chain OS=Homo sapiens OX=9606 GN=COL20A1 PE=1 SV=4
8	F1SKM1	4.21e-65	247	2938	0.173	0.082	F1SKM1_PIG Collagen type VII alpha 1 chain OS=Sus scrofa OX=9823 GN=COL7A1 PE=4 SV=2
9	Q02388	8.73e-62	236	2944	0.159	0.076	CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens OX=9606 GN=COL7A1 PE=1 SV=2
10	Q63870	4.06e-59	228	2944	0.158	0.075	CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus OX=10090 GN=Col7a1 PE=1 SV=3
11	O89029	5.48e-57	211	624	0.112	0.252	MATN4_MOUSE Matrilin-4 OS=Mus musculus OX=10090 GN=Matn4 PE=1 SV=1
12	O95460	6.84e-55	205	622	0.114	0.256	MATN4_HUMAN Matrilin-4 OS=Homo sapiens OX=9606 GN=MATN4 PE=1 SV=3
13	P07589	1.06e-49	197	2478	0.115	0.065	FINC_BOVIN Fibronectin OS=Bos taurus OX=9913 GN=FN1 PE=1 SV=4
14	Q6JAN2	3.24e-49	195	2408	0.123	0.071	Q6JAN2_DANRE Fibronectin OS=Danio rerio OX=7955 GN=wu:fb03c02 PE=1 SV=1
15	A2CEW3	1.85e-47	189	2500	0.119	0.066	A2CEW3_DANRE Fibronectin OS=Danio rerio OX=7955 GN=cb1057 PE=1 SV=2
16	U3JA51	3.48e-47	185	795	0.104	0.182	U3JA51_DANRE von Willebrand factor A domain-containing 2 OS=Danio rerio OX=7955 GN=vwa2 PE=1 SV=1
17	P02751	7.29e-47	187	2477	0.113	0.064	FINC_HUMAN Fibronectin OS=Homo sapiens OX=9606 GN=FN1 PE=1 SV=5
18	B0S602	1.32e-46	187	2480	0.123	0.069	B0S602_DANRE Fibronectin OS=Danio rerio OX=7955 GN=Fn PE=1 SV=1
19	Q5GFL6	1.93e-46	182	755	0.099	0.184	VWA2_HUMAN von Willebrand factor A domain-containing protein 2 OS=Homo sapiens OX=9606 GN=VWA2 PE=1 SV=1
20	P11276	3.29e-45	182	2477	0.116	0.065	FINC_MOUSE Fibronectin OS=Mus musculus OX=10090 GN=Fn1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01965 DJ-1_PfpI	7.1e+02	11.4	DJ-1/PfpI family
2	PF16389 DUF4998	1.6e-07	42.7	Domain of unknown function
3	PF00041 fn3	3.8e-108	365.4	Fibronectin type III domain
4	PF09294 Interfer-bind	2e-10	52.2	Interferon-alpha/beta receptor, fibronectin type III
5	PF10179 NDNF	2.2e-06	39.2	Neuron-derived neurotrophic factor, first Fn(III) domain
6	PF19433 NDNF_C	5.1e+02	11.6	Neuron-derived Neurotrophic Factor C-terminal
7	PF16656 Pur_ac_phosph_N	1.8e-12	59.0	Purple acid Phosphatase, N-terminal domain
8	PF18267 Rubredoxin_C	3.5e+02	12.5	Rubredoxin NAD+ reductase C-terminal domain
9	PF00092 VWA	5.8e-156	526.6	von Willebrand factor type A domain
10	PF13519 VWA_2	1.8e-44	162.2	von Willebrand factor type A domain
11	PF13768 VWA_3	2e-12	58.8	von Willebrand factor type A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000325146

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401749	0.927	Prolyl 4-hydroxylase subunit alpha-3
2	9606.ENSP00000458585	0.927	Macrophage metalloelastase
3	9606.ENSP00000384999	0.925	Prolyl 4-hydroxylase subunit alpha-2
4	9606.ENSP00000263556	0.917	Prolyl 4-hydroxylase subunit alpha-1
5	9606.ENSP00000362776	0.856	Collagen alpha-1(XVI) chain
6	9606.ENSP00000332371	0.847	Collagen alpha-1(VII) chain
7	9606.ENSP00000364000	0.807	Collagen alpha-2(V) chain
8	9606.ENSP00000349790	0.792	Collagen alpha-1(IX) chain
9	9606.ENSP00000434412	0.782	Serpin H1
10	9606.ENSP00000304408	0.779	Collagen alpha-1(III) chain
11	9606.ENSP00000361834	0.768	Collagen alpha-2(IX) chain
12	9606.ENSP00000196061	0.764	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
13	9606.ENSP00000297848	0.764	Collagen alpha-1(XIV) chain
14	9606.ENSP00000225964	0.759	Collagen alpha-1(I) chain
15	9606.ENSP00000341640	0.751	Collagen alpha-3(IX) chain
16	9606.ENSP00000282903	0.750	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
17	9606.ENSP00000360882	0.746	Collagen alpha-1(V) chain
18	9606.ENSP00000300527	0.743	Collagen alpha-2(VI) chain
19	9606.ENSP00000369071	0.742	Periostin
20	9606.ENSP00000236040	0.698	Prolyl 3-hydroxylase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044877	0.433	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.933	cellular process
GO:0032501	0.928	multicellular organismal process
GO:0007492	0.908	endoderm development
GO:0007275	0.903	multicellular organism development
GO:0009653	0.898	anatomical structure morphogenesis
GO:0001704	0.854	formation of primary germ layer
GO:0001706	0.837	endoderm formation
GO:0050789	0.506	regulation of biological process
GO:0035987	0.483	endodermal cell differentiation
GO:0050794	0.417	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	0.995	collagen-containing extracellular matrix
GO:0005576	0.992	extracellular region
GO:0005615	0.983	extracellular space
GO:0070013	0.827	intracellular organelle lumen
GO:0012505	0.825	endomembrane system
GO:0043227	0.801	membrane-bounded organelle
GO:0005783	0.724	endoplasmic reticulum
GO:0005788	0.688	endoplasmic reticulum lumen
GO:0031982	0.392	vesicle
GO:0032991	0.367	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]