StarFunc result for job id Q99717

User Input

>input (465 residues)
MTSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPG
QPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKE
VCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQP
NNTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQP
MDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
DPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNC
NFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGW
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97454	0.920	0.920	1.983E-93	465	0.989	0.989	P97454.pdb.gz	SMAD5_MOUSE Mothers against decapentaplegic homolog 5 OS=Mus musculus OX=10090 GN=Smad5 PE=1 SV=2
2	AFDB:P97588	0.852	0.846	1.075E-86	468	0.884	0.878	P97588.pdb.gz	SMAD1_RAT Mothers against decapentaplegic homolog 1 OS=Rattus norvegicus OX=10116 GN=Smad1 PE=2 SV=1
3	AFDB:Q9I8V2	0.781	0.771	8.962E-82	472	0.845	0.833	Q9I8V2.pdb.gz	SMAD1_DANRE Mothers against decapentaplegic homolog 1 OS=Danio rerio OX=7955 GN=smad1 PE=2 SV=1
4	AFDB:B2GS20	0.824	0.822	1.627E-81	466	0.804	0.803	B2GS20.pdb.gz
5	AFDB:F1P4N1	0.796	0.779	1.665E-80	476	0.811	0.792	F1P4N1.pdb.gz
6	AFDB:O54835	0.722	0.769	5.886E-77	434	0.763	0.818	O54835.pdb.gz	SMAD9_RAT Mothers against decapentaplegic homolog 9 OS=Rattus norvegicus OX=10116 GN=Smad9 PE=1 SV=1
7	AFDB:P42003	0.809	0.827	6.024E-76	455	0.727	0.743	P42003.pdb.gz	MAD_DROME Protein mothers against dpp OS=Drosophila melanogaster OX=7227 GN=Mad PE=1 SV=1
8	AFDB:P84023	0.760	0.827	1.181E-64	426	0.606	0.662	P84023.pdb.gz	SMAD3_CHICK Mothers against decapentaplegic homolog 3 OS=Gallus gallus OX=9031 GN=SMAD3 PE=2 SV=1
9	AFDB:Q9I9P9	0.750	0.745	4.330E-62	468	0.604	0.600	Q9I9P9.pdb.gz	SMAD2_DANRE Mothers against decapentaplegic homolog 2 OS=Danio rerio OX=7955 GN=smad2 PE=2 SV=1
10	AFDB:Q02330	0.432	0.480	1.843E-50	418	0.505	0.562	Q02330.pdb.gz	SMA2_CAEEL Dwarfin sma-2 OS=Caenorhabditis elegans OX=6239 GN=sma-2 PE=2 SV=2
11	PDB:7dvqX	0.182	0.480	7.995E-2	156	0.026	0.077	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
12	PDB:7wrgA	0.127	0.078	9.562E-2	812	0.049	0.028	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
13	PDB:7ea3J	0.087	0.051	5.078E-1	883	0.026	0.014	7ea3J.pdb.gz
14	PDB:7u05A	0.098	0.050	9.220E-1	1114	0.039	0.016	7u05A.pdb.gz
15	PDB:4l02A	0.078	0.092	1.103	360	0.041	0.053	4l02A.pdb.gz	Structure guided design of a series of sphingosine kinase (SphK) inhibitors.
16	PDB:2kb3A	0.139	0.378	1.170	143	0.034	0.112	2kb3A.pdb.gz
17	PDB:6uzyA	0.057	0.089	1.242	278	0.022	0.036	6uzyA.pdb.gz	Cryo-EM structures of the ATP release channel pannexin 1.
18	PDB:4arzA	0.049	0.066	1.486	291	0.028	0.045	4arzA.pdb.gz	Crystal Structure of the Gtr1Pgtp-Gtr2Pgdp Complex Reveals Large Structural Rearrangements Triggered by GTP-to-Gdp Conversion
19	PDB:6jkvA	0.073	0.126	1.486	230	0.032	0.065	6jkvA.pdb.gz	Crystal structure of PppA from Pseudomonas aeruginosa, a key regulatory component of type VI secretion systems.
20	PDB:1u0rD	0.068	0.100	1.886	301	0.039	0.060	1u0rD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	F1QXZ9	749	466	0.815	0.813	F1QXZ9_DANRE Mothers against decapentaplegic homolog OS=Danio rerio OX=7955 GN=sma8 PE=3 SV=1
2	O15198	739	467	0.789	0.786	SMAD9_HUMAN Mothers against decapentaplegic homolog 9 OS=Homo sapiens OX=9606 GN=SMAD9 PE=1 SV=1
3	O54835	678	434	0.761	0.816	SMAD9_RAT Mothers against decapentaplegic homolog 9 OS=Rattus norvegicus OX=10116 GN=Smad9 PE=1 SV=1
4	O70436	524	467	0.615	0.612	SMAD2_RAT Mothers against decapentaplegic homolog 2 OS=Rattus norvegicus OX=10116 GN=Smad2 PE=1 SV=1
5	P42003	687	455	0.735	0.752	MAD_DROME Protein mothers against dpp OS=Drosophila melanogaster OX=7227 GN=Mad PE=1 SV=1
6	P70340	844	465	0.899	0.899	SMAD1_MOUSE Mothers against decapentaplegic homolog 1 OS=Mus musculus OX=10090 GN=Smad1 PE=1 SV=2
7	P84022	538	425	0.606	0.664	SMAD3_HUMAN Mothers against decapentaplegic homolog 3 OS=Homo sapiens OX=9606 GN=SMAD3 PE=1 SV=1
8	P84023	539	426	0.613	0.669	SMAD3_CHICK Mothers against decapentaplegic homolog 3 OS=Gallus gallus OX=9031 GN=SMAD3 PE=2 SV=1
9	P84025	538	425	0.606	0.664	SMAD3_RAT Mothers against decapentaplegic homolog 3 OS=Rattus norvegicus OX=10116 GN=Smad3 PE=1 SV=1
10	P97454	958	465	0.989	0.989	SMAD5_MOUSE Mothers against decapentaplegic homolog 5 OS=Mus musculus OX=10090 GN=Smad5 PE=1 SV=2
11	P97588	833	468	0.884	0.878	SMAD1_RAT Mothers against decapentaplegic homolog 1 OS=Rattus norvegicus OX=10116 GN=Smad1 PE=2 SV=1
12	Q15796	523	467	0.615	0.612	SMAD2_HUMAN Mothers against decapentaplegic homolog 2 OS=Homo sapiens OX=9606 GN=SMAD2 PE=1 SV=1
13	Q15797	842	465	0.897	0.897	SMAD1_HUMAN Mothers against decapentaplegic homolog 1 OS=Homo sapiens OX=9606 GN=SMAD1 PE=1 SV=1
14	Q56I98	712	476	0.796	0.777	Q56I98_CHICK Mothers against decapentaplegic homolog OS=Gallus gallus OX=9031 GN=SMAD8 PE=2 SV=1
15	Q56I99	942	465	0.968	0.968	SMAD5_CHICK Mothers against decapentaplegic homolog 5 OS=Gallus gallus OX=9031 GN=SMAD5 PE=1 SV=1
16	Q56IA0	848	465	0.899	0.899	Q56IA0_CHICK Mothers against decapentaplegic homolog OS=Gallus gallus OX=9031 GN=SMAD1 PE=1 SV=1
17	Q62432	523	467	0.615	0.612	SMAD2_MOUSE Mothers against decapentaplegic homolog 2 OS=Mus musculus OX=10090 GN=Smad2 PE=1 SV=2
18	Q68DB7	967	465	1.000	1.000	Q68DB7_HUMAN Mothers against decapentaplegic homolog OS=Homo sapiens OX=9606 GN=DKFZp781O1323 PE=2 SV=1
19	Q6IRR4	518	467	0.611	0.608	Q6IRR4_XENLA Mothers against decapentaplegic homolog OS=Xenopus laevis OX=8355 GN=smad2.S PE=2 SV=1
20	Q8AY15	538	425	0.615	0.673	Q8AY15_DANRE Mothers against decapentaplegic homolog OS=Danio rerio OX=7955 GN=madh3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10401 IRF-3	5.6	18.2	Interferon-regulatory factor 3
2	PF03165 MH1	1.1e-38	142.9	MH1 domain
3	PF03166 MH2	3.5e-67	237.5	MH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 885580.XP_010612406.1

Rank	PPI partner	STRING score	Description
1	885580.XP_010605080.1	0.973	Serine/threonine-protein kinase receptor
2	885580.XP_010620883.1	0.973	Serine/threonine-protein kinase receptor
3	885580.XP_010637903.1	0.968	Serine/threonine-protein kinase receptor
4	885580.XP_010620044.1	0.966	Mothers against decapentaplegic homolog 7
5	885580.XP_010614518.1	0.959	Serine/threonine-protein kinase receptor
6	885580.XP_010620042.1	0.953	Mothers against decapentaplegic homolog
7	885580.XP_010641152.1	0.951	E3 ubiquitin-protein ligase SMURF1
8	885580.XP_010619101.1	0.927	Mitogen-activated protein kinase 1
9	885580.XP_010640391.1	0.924	Yorkie like protein
10	885580.XP_010615757.1	0.912	Mitogen-activated protein kinase 3
11	885580.XP_010633528.1	0.886	Mothers against decapentaplegic homolog
12	885580.XP_010605803.1	0.878	Bone morphogenetic protein 2
13	885580.XP_010609242.1	0.876	Mothers against decapentaplegic homolog 1
14	885580.XP_010630845.1	0.874	Bone morphogenetic protein 4
15	885580.XP_010612680.1	0.862	Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
16	885580.XP_010615145.1	0.861	E3 ubiquitin-protein ligase SMURF2
17	885580.XP_010626191.1	0.859	Ski oncogene
18	885580.XP_010619260.1	0.832	Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
19	885580.XP_010626878.1	0.829	Serine/threonine-protein kinase receptor R3 isoform X1
20	885580.XP_010617880.1	0.827	Serine/threonine-protein kinase receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.995	heterocyclic compound binding
GO:0097159	0.995	organic cyclic compound binding
GO:0001067	0.989	transcription regulatory region nucleic acid binding
GO:1990837	0.985	sequence-specific double-stranded DNA binding
GO:0000976	0.983	transcription cis-regulatory region binding
GO:0000977	0.921	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.909	cis-regulatory region sequence-specific DNA binding
GO:0140110	0.855	transcription regulator activity
GO:0003700	0.828	DNA-binding transcription factor activity
GO:0000978	0.827	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981	0.790	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0140297	0.450	DNA-binding transcription factor binding
GO:0042802	0.438	identical protein binding
GO:0019899	0.424	enzyme binding
GO:0001227	0.418	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0046332	0.326	SMAD binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0023052	0.991	signaling
GO:0007154	0.991	cell communication
GO:0045893	0.986	positive regulation of DNA-templated transcription
GO:0009719	0.985	response to endogenous stimulus
GO:0051716	0.985	cellular response to stimulus
GO:0048519	0.984	negative regulation of biological process
GO:0032501	0.983	multicellular organismal process
GO:0070848	0.982	response to growth factor
GO:0048856	0.979	anatomical structure development
GO:0007165	0.978	signal transduction
GO:0007178	0.962	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0071773	0.957	cellular response to BMP stimulus
GO:0007275	0.943	multicellular organism development
GO:0048523	0.942	negative regulation of cellular process
GO:0006357	0.925	regulation of transcription by RNA polymerase II
GO:0030509	0.923	BMP signaling pathway
GO:0048869	0.916	cellular developmental process
GO:0009892	0.748	negative regulation of metabolic process
GO:0010605	0.722	negative regulation of macromolecule metabolic process
GO:0030154	0.701	cell differentiation
GO:0050793	0.596	regulation of developmental process
GO:0023051	0.539	regulation of signaling
GO:0048583	0.527	regulation of response to stimulus
GO:0031324	0.522	negative regulation of cellular metabolic process
GO:0010646	0.513	regulation of cell communication
GO:0048731	0.510	system development
GO:0071704	0.492	organic substance metabolic process
GO:0051239	0.490	regulation of multicellular organismal process
GO:0051094	0.483	positive regulation of developmental process
GO:0045595	0.481	regulation of cell differentiation
GO:0045944	0.479	positive regulation of transcription by RNA polymerase II
GO:0051172	0.478	negative regulation of nitrogen compound metabolic process
GO:0048513	0.470	animal organ development
GO:0006807	0.446	nitrogen compound metabolic process
GO:0010558	0.446	negative regulation of macromolecule biosynthetic process
GO:0031327	0.442	negative regulation of cellular biosynthetic process
GO:0009966	0.428	regulation of signal transduction
GO:0045934	0.426	negative regulation of nucleobase-containing compound metabolic process
GO:0045892	0.419	negative regulation of DNA-templated transcription
GO:0043170	0.410	macromolecule metabolic process
GO:0045597	0.403	positive regulation of cell differentiation
GO:0044238	0.399	primary metabolic process
GO:0044237	0.387	cellular metabolic process
GO:0071559	0.321	response to transforming growth factor beta
GO:0042221	0.314	response to chemical
GO:0051240	0.311	positive regulation of multicellular organismal process
GO:0071560	0.307	cellular response to transforming growth factor beta stimulus
GO:0042127	0.305	regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.998	cytoplasm
GO:0070013	0.979	intracellular organelle lumen
GO:0031981	0.698	nuclear lumen
GO:0005654	0.642	nucleoplasm
GO:0032991	0.491	protein-containing complex
GO:0005829	0.433	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]