StarFunc result for job id Q99728

User Input

>input (777 residues)
MPDNRQPRNRQPRIRSGNEPRSAPAMEPDGRGAWAHSRAALDRLEKLLRCSRCTNILREP
VCLGGCEHIFCSNCVSDCIGTGCPVCYTPAWIQDLKINRQLDSMIQLCSKLRNLLHDNEL
SDLKEDKPRKSLFNDAGNKKNSIKMWFSPRSKKVRYVVSKASVQTQPAIKKDASAQQDSY
EFVSPSPPADVSERAKKASARSGKKQKKKTLAEINQKWNLEAEKEDGEFDSKEESKQKLV
SFCSQPSVISSPQINGEIDLLASGSLTESECFGSLTEVSLPLAEQIESPDTKSRNEVVTP
EKVCKNYLTSKKSLPLENNGKRGHHNRLSSPISKRCRTSILSTSGDFVKQTVPSENIPLP
ECSSPPSCKRKVGGTSGRKNSNMSDEFISLSPGTPPSTLSSSSYRRVMSSPSAMKLLPNM
AVKRNHRGETLLHIASIKGDIPSVEYLLQNGSDPNVKDHAGWTPLHEACNHGHLKVVELL
LQHKALVNTTGYQNDSPLHDAAKNGHVDIVKLLLSYGASRNAVNIFGLRPVDYTDDESMK
SLLLLPEKNESSSASHCSVMNTGQRRDGPLVLIGSGLSSEQQKMLSELAVILKAKKYTEF
DSTVTHVVVPGDAVQSTLKCMLGILNGCWILKFEWVKACLRRKVCEQEEKYEIPEGPRRS
RLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTV
AYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWKAPSSWFIDCVMSFELLPLDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0AVN2	0.525	0.525	0.000	777	0.996	0.996	A0AVN2.pdb.gz	A0AVN2_HUMAN BRCA1 associated RING domain 1 OS=Homo sapiens OX=9606 GN=BARD1 PE=1 SV=1
2	AFDB:A0A087X2H0	0.574	0.681	8.097E-97	641	0.824	0.998	A0A087X2H0.pdb.gz	A0A087X2H0_HUMAN BRCA1 associated RING domain 1 OS=Homo sapiens OX=9606 GN=BARD1 PE=1 SV=2
3	AFDB:Q9QZH2	0.597	0.603	3.537E-89	768	0.685	0.693	Q9QZH2.pdb.gz	BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus OX=10116 GN=Bard1 PE=2 SV=1
4	AFDB:O70445	0.585	0.594	3.714E-85	765	0.698	0.708	O70445.pdb.gz	BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus OX=10090 GN=Bard1 PE=2 SV=1
5	AFDB:Q90X95	0.499	0.502	1.719E-70	772	0.471	0.474	Q90X95.pdb.gz	Q90X95_XENLA BRCA1 associated RING domain 1 L homeolog OS=Xenopus laevis OX=8355 GN=bard1.L PE=1 SV=1
6	AFDB:C9IYG1	0.312	0.726	1.369E-44	326	0.327	0.779	C9IYG1.pdb.gz	C9IYG1_HUMAN BRCA1 associated RING domain 1 OS=Homo sapiens OX=9606 GN=BARD1 PE=1 SV=2
7	AFDB:Q8CGN4	0.161	0.076	5.836E-10	1759	0.134	0.059	Q8CGN4.pdb.gz	BCOR_MOUSE BCL-6 corepressor OS=Mus musculus OX=10090 GN=Bcor PE=1 SV=2
8	AFDB:Q6W2J9	0.154	0.071	9.385E-9	1755	0.144	0.064	Q6W2J9.pdb.gz	BCOR_HUMAN BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=1
9	PDB:8cs9A	0.149	0.146	5.892E-8	796	0.059	0.058	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
10	PDB:2dvwA	0.156	0.525	6.221E-8	229	0.054	0.183	2dvwA.pdb.gz
11	AFDB:F1RCL8	0.152	0.068	7.852E-8	1796	0.149	0.065	F1RCL8.pdb.gz	F1RCL8_DANRE BCL-6 corepressor isoform X1 OS=Danio rerio OX=7955 GN=bcor PE=1 SV=1
12	PDB:6jd6B	0.153	0.586	1.334E-7	192	0.051	0.208	6jd6B.pdb.gz
13	PDB:3ehqA	0.150	0.625	1.751E-7	182	0.051	0.220	3ehqA.pdb.gz
14	PDB:7df7B	0.141	0.877	2.062E-7	119	0.050	0.328	7df7B.pdb.gz
15	PDB:1wg0A	0.161	0.494	3.366E-7	243	0.057	0.181	1wg0A.pdb.gz
16	PDB:6mwqA	0.150	0.235	3.555E-7	493	0.098	0.154	6mwqA.pdb.gz
17	PDB:5vkqA	0.151	0.079	6.129E-7	1499	0.053	0.027	5vkqA.pdb.gz
18	PDB:4oauC	0.147	0.165	1.387E-6	692	0.050	0.056	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
19	AFDB:Q99549	0.156	0.141	1.570E-6	860	0.125	0.113	Q99549.pdb.gz	MPP8_HUMAN M-phase phosphoprotein 8 OS=Homo sapiens OX=9606 GN=MPHOSPH8 PE=1 SV=2
20	PDB:1bd8A	0.133	0.601	1.725E-6	156	0.044	0.218	1bd8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087X2H0	0.0	618	641	0.389	0.471	A0A087X2H0_HUMAN BRCA1 associated RING domain 1 OS=Homo sapiens OX=9606 GN=BARD1 PE=1 SV=2
2	A0AVN2	0.0	1602	777	0.996	0.996	A0AVN2_HUMAN BRCA1 associated RING domain 1 OS=Homo sapiens OX=9606 GN=BARD1 PE=1 SV=1
3	C9IYG1	0.0	536	326	0.327	0.779	C9IYG1_HUMAN BRCA1 associated RING domain 1 OS=Homo sapiens OX=9606 GN=BARD1 PE=1 SV=2
4	F6MDI1	0.0	537	307	0.327	0.827	F6MDI1_HUMAN BRCA1 associated RING domain 1 OS=Homo sapiens OX=9606 GN=BARD1 PE=1 SV=1
5	O70445	0.0	1087	765	0.699	0.710	BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus OX=10090 GN=Bard1 PE=2 SV=1
6	Q90X95	0.0	637	772	0.476	0.479	Q90X95_XENLA BRCA1 associated RING domain 1 L homeolog OS=Xenopus laevis OX=8355 GN=bard1.L PE=1 SV=1
7	Q99728	0.0	1607	777	1.000	1.000	BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens OX=9606 GN=BARD1 PE=1 SV=2
8	Q9QZH2	0.0	1060	768	0.686	0.694	BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus OX=10116 GN=Bard1 PE=2 SV=1
9	Q6PG48	7.97e-33	132	330	0.081	0.191	Q6PG48_HUMAN ANKRD12 protein OS=Homo sapiens OX=9606 GN=ANKRD12 PE=1 SV=1
10	Q59GC3	3.47e-31	129	439	0.081	0.144	Q59GC3_HUMAN Ankyrin repeat domain 11 variant (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
11	Q6UB98	8.04e-31	133	2062	0.081	0.031	ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ANKRD12 PE=1 SV=3
12	Q6UB99	7.32e-30	130	2663	0.082	0.024	ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=3
13	E9Q4F7	8.39e-30	130	2643	0.081	0.024	ANR11_MOUSE Ankyrin repeat domain-containing protein 11 OS=Mus musculus OX=10090 GN=Ankrd11 PE=1 SV=1
14	X5D778	4.50e-24	107	421	0.064	0.119	X5D778_HUMAN Ankyrin repeat domain 11 isoform A (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=1
15	Q8RXD4	3.17e-22	105	941	0.093	0.077	BRCA1_ARATH Protein BREAST CANCER SUSCEPTIBILITY 1 homolog OS=Arabidopsis thaliana OX=3702 GN=BRCA1 PE=1 SV=1
16	F4I443	3.20e-22	104	714	0.088	0.095	BARD1_ARATH BRCA1-associated RING domain protein 1 OS=Arabidopsis thaliana OX=3702 GN=BARD1 PE=1 SV=1
17	Q96HA7	4.03e-22	105	1378	0.068	0.038	TONSL_HUMAN Tonsoku-like protein OS=Homo sapiens OX=9606 GN=TONSL PE=1 SV=2
18	Q9H2K2	1.75e-18	93.2	1166	0.063	0.042	TNKS2_HUMAN Poly [ADP-ribose] polymerase tankyrase-2 OS=Homo sapiens OX=9606 GN=TNKS2 PE=1 SV=1
19	Q3UES3	2.14e-18	92.8	1166	0.063	0.042	TNKS2_MOUSE Poly [ADP-ribose] polymerase tankyrase-2 OS=Mus musculus OX=10090 GN=Tnks2 PE=2 SV=2
20	Q9VBP3	4.53e-18	91.7	1181	0.059	0.039	TNKS_DROME Poly [ADP-ribose] polymerase tankyrase OS=Drosophila melanogaster OX=7227 GN=Tnks PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	7.1e-15	65.9	Ankyrin repeat
2	PF12796 Ank_2	1.1e-21	88.5	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	1.5e-14	63.5	Ankyrin repeat
4	PF13637 Ank_4	6.7e-18	76.1	Ankyrin repeats (many copies)
5	PF13857 Ank_5	7.4e-16	69.3	Ankyrin repeats (many copies)
6	PF00533 BRCT	0.00033	32.3	BRCA1 C Terminus (BRCT) domain
7	PF16589 BRCT_2	4.4e-05	35.1	BRCT domain, a BRCA1 C-terminus domain
8	PF05458 Siva	2.4e+02	12.8	Cd27 binding protein (Siva)
9	PF00097 zf-C3HC4	1.3e+02	13.8	Zinc finger, C3HC4 type (RING finger)
10	PF13923 zf-C3HC4_2	3.1e+02	12.6	Zinc finger, C3HC4 type (RING finger)
11	PF13920 zf-C3HC4_3	3.1e+02	12.6	Zinc finger, C3HC4 type (RING finger)
12	PF13639 zf-RING_2	6.6e+02	12.1	Ring finger domain
13	PF14634 zf-RING_5	1.1	20.6	zinc-RING finger domain
14	PF14835 zf-RING_6	2.1e-40	147.8	zf-RING of BARD1-type protein
15	PF13445 zf-RING_UBOX	4.5e+02	12.3	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000260947

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000217109	0.999	Cleavage stimulation factor subunit 1
2	9606.ENSP00000269305	0.999	Cellular tumor antigen p53
3	9606.ENSP00000418960	0.999	Breast cancer type 1 susceptibility protein
4	9606.ENSP00000366434	0.998	BRCA1-A complex subunit RAP80
5	9606.ENSP00000369497	0.998	Breast cancer type 2 susceptibility protein
6	9606.ENSP00000382628	0.998	DNA endonuclease RBBP8
7	9606.ENSP00000372088	0.997	DNA repair protein RAD51 homolog 1
8	9606.ENSP00000369857	0.996	BRCA1-A complex subunit Abraxas 1
9	9606.ENSP00000349722	0.995	Ubiquitin conjugating enzyme E2 D3
10	9606.ENSP00000358474	0.991	Lys-63-specific deubiquitinase BRCC36
11	9606.ENSP00000400142	0.986	RNA-binding protein EWS
12	9606.ENSP00000343412	0.983	BRISC and BRCA1-A complex member 2
13	9606.ENSP00000278616	0.978	Serine-protein kinase ATM
14	9606.ENSP00000325863	0.978	Double-strand break repair protein MRE11
15	9606.ENSP00000260810	0.972	DNA topoisomerase 2-binding protein 1
16	9606.ENSP00000352257	0.971	X-ray repair cross-complementing protein 6
17	9606.ENSP00000265433	0.967	Nibrin
18	9606.ENSP00000259008	0.965	Fanconi anemia group J protein
19	9606.ENSP00000287647	0.965	Fanconi anemia group D2 protein
20	9606.ENSP00000352408	0.961	BRISC and BRCA1-A complex member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0097159	0.678	organic cyclic compound binding
GO:1901363	0.677	heterocyclic compound binding
GO:0003676	0.592	nucleic acid binding
GO:0140096	0.541	catalytic activity, acting on a protein
GO:0016740	0.512	transferase activity
GO:0019899	0.362	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0050896	0.984	response to stimulus
GO:0071704	0.970	organic substance metabolic process
GO:0044238	0.968	primary metabolic process
GO:0048523	0.938	negative regulation of cellular process
GO:0051716	0.931	cellular response to stimulus
GO:0006807	0.915	nitrogen compound metabolic process
GO:0048522	0.896	positive regulation of cellular process
GO:0043170	0.877	macromolecule metabolic process
GO:0071478	0.857	cellular response to radiation
GO:0060341	0.848	regulation of cellular localization
GO:0019538	0.838	protein metabolic process
GO:0032501	0.818	multicellular organismal process
GO:0019222	0.818	regulation of metabolic process
GO:0033554	0.811	cellular response to stress
GO:0070647	0.809	protein modification by small protein conjugation or removal
GO:0032386	0.808	regulation of intracellular transport
GO:0045185	0.808	maintenance of protein location
GO:0032507	0.797	maintenance of protein location in cell
GO:0010941	0.777	regulation of cell death
GO:0046822	0.776	regulation of nucleocytoplasmic transport
GO:0072595	0.776	maintenance of protein localization in organelle
GO:0044237	0.764	cellular metabolic process
GO:0033157	0.755	regulation of intracellular protein transport
GO:0031323	0.752	regulation of cellular metabolic process
GO:0032387	0.736	negative regulation of intracellular transport
GO:0034504	0.720	protein localization to nucleus
GO:0060255	0.695	regulation of macromolecule metabolic process
GO:0090317	0.687	negative regulation of intracellular protein transport
GO:0051171	0.675	regulation of nitrogen compound metabolic process
GO:0051457	0.671	maintenance of protein location in nucleus
GO:0043067	0.662	regulation of programmed cell death
GO:0080090	0.654	regulation of primary metabolic process
GO:0016567	0.638	protein ubiquitination
GO:0010212	0.627	response to ionizing radiation
GO:0046825	0.492	regulation of protein export from nucleus
GO:0042981	0.491	regulation of apoptotic process
GO:0009893	0.489	positive regulation of metabolic process
GO:0051173	0.393	positive regulation of nitrogen compound metabolic process
GO:0019219	0.376	regulation of nucleobase-containing compound metabolic process
GO:0010604	0.366	positive regulation of macromolecule metabolic process
GO:0071479	0.355	cellular response to ionizing radiation
GO:0006974	0.352	cellular response to DNA damage stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0032991	0.996	protein-containing complex
GO:0005737	0.983	cytoplasm
GO:0016604	0.959	nuclear body
GO:0140513	0.920	nuclear protein-containing complex
GO:1902494	0.890	catalytic complex
GO:1990234	0.843	transferase complex
GO:0140535	0.830	intracellular protein-containing complex
GO:0099080	0.616	supramolecular complex
GO:0016607	0.489	nuclear speck
GO:0036464	0.446	cytoplasmic ribonucleoprotein granule
GO:0000152	0.423	nuclear ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.512	Transferases.

[back to server]