StarFunc result for job id Q99732

User Input

>input (161 residues)
MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPS
YYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCG
SLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99732	0.999	0.999	5.065E-28	161	1.000	1.000	Q99732.pdb.gz	LITAF_HUMAN Lipopolysaccharide-induced tumor necrosis factor-alpha factor OS=Homo sapiens OX=9606 GN=LITAF PE=1 SV=2
2	AFDB:P0C0T0	0.562	0.562	8.868E-26	161	0.870	0.870	P0C0T0.pdb.gz	LITAF_RAT Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog OS=Rattus norvegicus OX=10116 GN=Litaf PE=2 SV=1
3	AFDB:Q8QGW7	0.544	0.588	1.522E-18	148	0.621	0.676	Q8QGW7.pdb.gz	LITAF_CHICK Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog OS=Gallus gallus OX=9031 GN=LITAF PE=2 SV=1
4	AFDB:Q54HX8	0.492	0.441	9.499E-11	181	0.304	0.271	Q54HX8.pdb.gz	CDIP1_DICDI Cell death-inducing p53-target protein 1 homolog OS=Dictyostelium discoideum OX=44689 GN=litaf PE=3 SV=1
5	AFDB:Q9W221	0.444	0.545	9.302E-9	129	0.248	0.310	Q9W221.pdb.gz	Q9W221_DROME MIP04282p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG13510 PE=1 SV=2
6	AFDB:G5EGQ9	0.402	0.068	7.036E-7	1025	0.161	0.025	G5EGQ9.pdb.gz	G5EGQ9_CAEEL LITAF domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nmr-1 PE=2 SV=1
7	AFDB:Q9H305	0.350	0.281	1.059E-5	208	0.329	0.255	Q9H305.pdb.gz	CDIP1_HUMAN Cell death-inducing p53-target protein 1 OS=Homo sapiens OX=9606 GN=CDIP1 PE=1 SV=1
8	PDB:5apno	0.194	0.274	2.642E-1	105	0.081	0.124	5apno.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
9	PDB:5aj0Ao	0.185	0.266	4.724E-1	105	0.075	0.114	5aj0Ao.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
10	PDB:7vbcI	0.163	0.230	5.039E-1	107	0.099	0.150	7vbcI.pdb.gz	Structure of the human RNA polymerase I elongation complex.
11	PDB:7q4pC	0.203	0.057	5.375E-1	878	0.056	0.010	7q4pC.pdb.gz	Structural basis of branch site recognition by the human spliceosome.
12	AFDB:Q8IGN3	0.120	0.033	8.019E-1	949	0.112	0.019	Q8IGN3.pdb.gz	Q8IGN3_DROME RE59052p OS=Drosophila melanogaster OX=7227 GN=CG6867 PE=2 SV=1
13	PDB:4v6wCo	0.205	0.297	1.244	104	0.056	0.087	4v6wCo.pdb.gz	Structures of the human and Drosophila 80S ribosome.
14	PDB:7dvq3	0.174	0.041	1.327	1193	0.056	0.008	7dvq3.pdb.gz	Structure of the activated human minor spliceosome.
15	AFDB:Q99KE8	0.106	0.044	1.434	643	0.099	0.025	Q99KE8.pdb.gz	ZFP64_MOUSE Zinc finger protein 64 OS=Mus musculus OX=10090 GN=Zfp64 PE=1 SV=1
16	PDB:5svbC	0.146	0.142	1.510	167	0.043	0.042	5svbC.pdb.gz	Structural Basis for the Mechanism of ATP-Dependent Acetone Carboxylation.
17	PDB:4btsA9	0.141	0.226	1.833	93	0.062	0.108	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
18	PDB:4c2mI	0.167	0.204	1.955	124	0.056	0.073	4c2mI.pdb.gz	RNA Polymerase I Structure and Transcription Regulation.
19	PDB:5fj9I	0.205	0.322	1.955	92	0.050	0.087	5fj9I.pdb.gz	Molecular Structures of Unbound and Transcribing RNA Polymerase III.
20	AFDB:Q9JHS4	0.141	0.044	1.980	634	0.124	0.032	Q9JHS4.pdb.gz	CLPX_MOUSE ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Mus musculus OX=10090 GN=Clpx PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99732	2.21e-115	325	161	1.000	1.000	LITAF_HUMAN Lipopolysaccharide-induced tumor necrosis factor-alpha factor OS=Homo sapiens OX=9606 GN=LITAF PE=1 SV=2
2	I3L3U8	6.90e-109	308	153	0.950	1.000	I3L3U8_HUMAN Lipopolysaccharide induced TNF factor (Fragment) OS=Homo sapiens OX=9606 GN=LITAF PE=1 SV=8
3	I3L1I9	3.21e-95	273	137	0.851	1.000	I3L1I9_HUMAN Lipopolysaccharide induced TNF factor (Fragment) OS=Homo sapiens OX=9606 GN=LITAF PE=1 SV=1
4	P0C0T0	7.44e-94	270	161	0.870	0.870	LITAF_RAT Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog OS=Rattus norvegicus OX=10116 GN=Litaf PE=2 SV=1
5	Q9JLJ0	7.61e-93	268	161	0.857	0.857	LITAF_MOUSE Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog OS=Mus musculus OX=10090 GN=Litaf PE=1 SV=1
6	I3L329	3.52e-86	250	126	0.783	1.000	I3L329_HUMAN Lipopolysaccharide induced TNF factor OS=Homo sapiens OX=9606 GN=LITAF PE=1 SV=1
7	I3L1P1	4.51e-86	250	136	0.783	0.926	I3L1P1_HUMAN Lipopolysaccharide induced TNF factor (Fragment) OS=Homo sapiens OX=9606 GN=LITAF PE=1 SV=1
8	Q8QGW7	2.28e-63	193	148	0.615	0.669	LITAF_CHICK Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog OS=Gallus gallus OX=9031 GN=LITAF PE=2 SV=1
9	Q9H305	1.48e-15	72.8	208	0.205	0.159	CDIP1_HUMAN Cell death-inducing p53-target protein 1 OS=Homo sapiens OX=9606 GN=CDIP1 PE=1 SV=1
10	Q54HX8	8.23e-15	70.1	181	0.180	0.160	CDIP1_DICDI Cell death-inducing p53-target protein 1 homolog OS=Dictyostelium discoideum OX=44689 GN=litaf PE=3 SV=1
11	Q9W221	3.13e-09	54.3	129	0.168	0.209	Q9W221_DROME MIP04282p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG13510 PE=1 SV=2
12	Q9XWU3	1.64e-06	46.2	101	0.155	0.248	Q9XWU3_CAEEL LITAF domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_Y41C4A.11 PE=3 SV=2
13	G5EGQ9	3.48e-05	45.1	1025	0.124	0.020	G5EGQ9_CAEEL LITAF domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nmr-1 PE=2 SV=1
14	Q9W1P0	1.15e-04	41.6	114	0.118	0.167	Q9W1P0_DROME FI16602p1 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG13559 PE=2 SV=1
15	Q9UPT6	0.048	35.8	1336	0.149	0.018	JIP3_HUMAN C-Jun-amino-terminal kinase-interacting protein 3 OS=Homo sapiens OX=9606 GN=MAPK8IP3 PE=1 SV=3
16	Q9W111	0.36	33.1	1253	0.149	0.019	Q9W111_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform A OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=2
17	Q8WQ61	0.37	33.1	1253	0.149	0.019	Q8WQ61_DROME Eps-15 protein OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=2 SV=1
18	A0A2C9C2L6	0.41	33.1	624	0.143	0.037	A0A2C9C2L6_CAEEL Intraflagellar transport protein 74 homolog OS=Caenorhabditis elegans OX=6239 GN=ift-74 PE=4 SV=1
19	Q8MMD2	0.41	33.1	1232	0.149	0.019	Q8MMD2_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform B OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1
20	E9PV66	0.50	32.7	2605	0.118	0.007	E9PV66_MOUSE Myosin XVIIIb OS=Mus musculus OX=10090 GN=Myo18b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20097 DUF6487	34	16.2	Domain of unknown function (DUF6487)
2	PF10601 zf-LITAF-like	6.4e-21	85.7	LITAF-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000459533

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300134	0.935	Signal transducer and activator of transcription 6
2	9606.ENSP00000424827	0.934	E3 ubiquitin-protein ligase NEDD4
3	9606.ENSP00000251968	0.899	Tumor susceptibility gene 101 protein
4	9606.ENSP00000423660	0.872	SH3 domain and tetratricopeptide repeats 2
5	9606.ENSP00000358081	0.804	BAG family molecular chaperone regulator 3
6	9606.ENSP00000352540	0.764	Epithelial membrane protein 2
7	9606.ENSP00000457230	0.760	WW domain-containing oxidoreductase
8	9606.ENSP00000480499	0.757	E3 ubiquitin-protein ligase Itchy homolog
9	9606.ENSP00000385675	0.748	Interleukin-6
10	9606.ENSP00000263341	0.735	Interleukin-1 beta
11	9606.ENSP00000373328	0.712	Cell death activator CIDE-3
12	9606.ENSP00000412237	0.701	Interleukin-10
13	9606.ENSP00000344192	0.696	Interleukin-17A
14	9606.ENSP00000432943	0.682	Myelin protein P0
15	9606.ENSP00000220822	0.681	Ganglioside-induced differentiation-associated protein 1
16	9606.ENSP00000011653	0.668	T-cell surface glycoprotein CD4
17	9606.ENSP00000355133	0.664	Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein
18	9606.ENSP00000230124	0.660	Polyphosphoinositide phosphatase
19	9606.ENSP00000363134	0.652	Gap junction beta-1 protein
20	9606.ENSP00000262865	0.648	Bactericidal permeability-increasing protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.987	nucleic acid binding
GO:0042802	0.979	identical protein binding
GO:0001228	0.917	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0043167	0.912	ion binding
GO:0000987	0.906	cis-regulatory region sequence-specific DNA binding
GO:0046872	0.896	metal ion binding
GO:0050699	0.879	WW domain binding
GO:0008270	0.813	zinc ion binding
GO:0000978	0.810	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.990	regulation of cellular process
GO:0019222	0.972	regulation of metabolic process
GO:0060255	0.952	regulation of macromolecule metabolic process
GO:0048583	0.938	regulation of response to stimulus
GO:0009987	0.930	cellular process
GO:0048522	0.915	positive regulation of cellular process
GO:0023051	0.910	regulation of signaling
GO:0010646	0.910	regulation of cell communication
GO:1902531	0.899	regulation of intracellular signal transduction
GO:0010468	0.895	regulation of gene expression
GO:0050896	0.890	response to stimulus
GO:1902533	0.821	positive regulation of intracellular signal transduction
GO:0051716	0.668	cellular response to stimulus
GO:0031323	0.628	regulation of cellular metabolic process
GO:0080090	0.626	regulation of primary metabolic process
GO:0051171	0.624	regulation of nitrogen compound metabolic process
GO:0009893	0.617	positive regulation of metabolic process
GO:0010604	0.604	positive regulation of macromolecule metabolic process
GO:0043122	0.585	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0032502	0.570	developmental process
GO:0042221	0.522	response to chemical
GO:0031326	0.517	regulation of cellular biosynthetic process
GO:0051252	0.515	regulation of RNA metabolic process
GO:2001141	0.514	regulation of RNA biosynthetic process
GO:0071704	0.478	organic substance metabolic process
GO:0048519	0.466	negative regulation of biological process
GO:1903506	0.466	regulation of nucleic acid-templated transcription
GO:0043123	0.455	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0048523	0.454	negative regulation of cellular process
GO:0044419	0.420	biological process involved in interspecies interaction between organisms
GO:0032501	0.420	multicellular organismal process
GO:0009605	0.419	response to external stimulus
GO:0031325	0.372	positive regulation of cellular metabolic process
GO:0006355	0.333	regulation of DNA-templated transcription
GO:0009607	0.325	response to biotic stimulus
GO:0070887	0.321	cellular response to chemical stimulus
GO:0043207	0.311	response to external biotic stimulus
GO:0051239	0.310	regulation of multicellular organismal process
GO:0051173	0.304	positive regulation of nitrogen compound metabolic process
GO:0071216	0.302	cellular response to biotic stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0012505	0.998	endomembrane system
GO:0031981	0.997	nuclear lumen
GO:0016020	0.995	membrane
GO:0005654	0.993	nucleoplasm
GO:0005886	0.971	plasma membrane
GO:0005576	0.969	extracellular region
GO:0031090	0.969	organelle membrane
GO:0005794	0.885	Golgi apparatus
GO:0098588	0.882	bounding membrane of organelle
GO:0031982	0.859	vesicle
GO:0031410	0.729	cytoplasmic vesicle
GO:0005773	0.635	vacuole
GO:0005774	0.613	vacuolar membrane
GO:0000323	0.532	lytic vacuole
GO:0005764	0.510	lysosome
GO:0098852	0.500	lytic vacuole membrane
GO:0005765	0.489	lysosomal membrane
GO:0005768	0.403	endosome
GO:0030659	0.387	cytoplasmic vesicle membrane
GO:0005615	0.372	extracellular space
GO:0010008	0.352	endosome membrane
GO:0005829	0.342	cytosol
GO:0005769	0.308	early endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]