StarFunc result for job id Q99748

User Input

>input (197 residues)
MQRWKAAALASVLCSSVLSIWMCREGLLLSHRLGPALVPLHRLPRTLDARIARLAQYRAL
LQGAPDAMELRELTPWAGRPPGPRRRAGPRRRRARARLGARPCGLRELEVRVSELGLGYA
SDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAH
SRYHTVHELSARECACV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99748	1.000	1.000	2.658E-33	197	1.000	1.000	Q99748.pdb.gz	NRTN_HUMAN Neurturin OS=Homo sapiens OX=9606 GN=NRTN PE=1 SV=1
2	AFDB:P97463	0.518	0.523	3.169E-28	195	0.863	0.872	P97463.pdb.gz	NRTN_MOUSE Neurturin OS=Mus musculus OX=10090 GN=Nrtn PE=1 SV=1
3	AFDB:Q5T4W7	0.502	0.453	2.167E-12	220	0.365	0.327	Q5T4W7.pdb.gz	ARTN_HUMAN Artemin OS=Homo sapiens OX=9606 GN=ARTN PE=1 SV=1
4	AFDB:Q6AYE8	0.464	0.410	3.256E-12	224	0.355	0.312	Q6AYE8.pdb.gz	ARTN_RAT Artemin OS=Rattus norvegicus OX=10116 GN=Artn PE=2 SV=1
5	AFDB:P39905	0.441	0.414	1.315E-11	211	0.279	0.261	P39905.pdb.gz	GDNF_HUMAN Glial cell line-derived neurotrophic factor OS=Homo sapiens OX=9606 GN=GDNF PE=1 SV=1
6	AFDB:Q98TU0	0.473	0.400	2.800E-11	235	0.269	0.226	Q98TU0.pdb.gz	GDNF_DANRE Glial cell line-derived neurotrophic factor OS=Danio rerio OX=7955 GN=gdnf PE=1 SV=1
7	AFDB:O70300	0.401	0.496	3.038E-10	156	0.284	0.359	O70300.pdb.gz	PSPN_MOUSE Persephin OS=Mus musculus OX=10090 GN=Pspn PE=2 SV=1
8	AFDB:O60542	0.403	0.497	8.164E-10	156	0.284	0.359	O60542.pdb.gz	PSPN_HUMAN Persephin OS=Homo sapiens OX=9606 GN=PSPN PE=2 SV=1
9	PDB:6q2sA	0.446	0.860	1.268E-9	98	0.234	0.469	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.
10	AFDB:P12645	0.319	0.157	2.145E-5	472	0.203	0.085	P12645.pdb.gz	BMP3_HUMAN Bone morphogenetic protein 3 OS=Homo sapiens OX=9606 GN=BMP3 PE=1 SV=2
11	AFDB:Q7T2X6	0.329	0.172	2.145E-5	443	0.168	0.074	Q7T2X6.pdb.gz	GDF10_XENLA Growth/differentiation factor 10 OS=Xenopus laevis OX=8355 GN=gdf10 PE=1 SV=1
12	PDB:5vqfB	0.298	0.197	1.842E-3	320	0.107	0.066	5vqfB.pdb.gz
13	PDB:3rjrC	0.296	0.182	5.561E-3	343	0.122	0.070	3rjrC.pdb.gz
14	PDB:6umxA	0.250	0.183	1.886E-2	279	0.081	0.057	6umxA.pdb.gz
15	PDB:4mqwB	0.276	0.440	1.999E-2	109	0.096	0.174	4mqwB.pdb.gz
16	PDB:4my2A	0.301	0.137	2.522E-2	474	0.102	0.042	4my2A.pdb.gz	Structure and function of Norrin in assembly and activation of a Frizzled 4-Lrp5/6 complex.
17	PDB:5nxsA	0.279	0.199	5.693E-2	290	0.102	0.069	5nxsA.pdb.gz
18	PDB:1hcnB	0.282	0.450	1.285E-1	110	0.102	0.182	1hcnB.pdb.gz
19	PDB:5ntuA	0.304	0.206	1.443E-1	308	0.117	0.075	5ntuA.pdb.gz
20	PDB:2k8pA	0.227	0.233	1.621E-1	189	0.157	0.164	2k8pA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99748	2.01e-136	381	197	1.000	1.000	NRTN_HUMAN Neurturin OS=Homo sapiens OX=9606 GN=NRTN PE=1 SV=1
2	P97463	7.37e-90	263	195	0.848	0.856	NRTN_MOUSE Neurturin OS=Mus musculus OX=10090 GN=Nrtn PE=1 SV=1
3	Q811Q5	6.76e-87	256	195	0.832	0.841	Q811Q5_RAT Neurturin OS=Rattus norvegicus OX=10116 GN=Nrtn PE=3 SV=1
4	Q98TU0	1.47e-24	98.2	235	0.223	0.187	GDNF_DANRE Glial cell line-derived neurotrophic factor OS=Danio rerio OX=7955 GN=gdnf PE=1 SV=1
5	Q6AYE8	5.29e-20	85.9	224	0.269	0.237	ARTN_RAT Artemin OS=Rattus norvegicus OX=10116 GN=Artn PE=2 SV=1
6	O60542	1.40e-19	83.2	156	0.239	0.301	PSPN_HUMAN Persephin OS=Homo sapiens OX=9606 GN=PSPN PE=2 SV=1
7	Q9Z0L2	2.68e-19	84.0	224	0.249	0.219	ARTN_MOUSE Artemin OS=Mus musculus OX=10090 GN=Artn PE=1 SV=1
8	O70300	5.93e-19	81.6	156	0.239	0.301	PSPN_MOUSE Persephin OS=Mus musculus OX=10090 GN=Pspn PE=2 SV=1
9	Q07731	6.08e-19	82.8	211	0.269	0.251	GDNF_RAT Glial cell line-derived neurotrophic factor OS=Rattus norvegicus OX=10116 GN=Gdnf PE=1 SV=1
10	Q5T4W7	6.65e-19	82.8	220	0.274	0.245	ARTN_HUMAN Artemin OS=Homo sapiens OX=9606 GN=ARTN PE=1 SV=1
11	P48540	1.08e-18	82.0	211	0.264	0.246	GDNF_MOUSE Glial cell line-derived neurotrophic factor OS=Mus musculus OX=10090 GN=Gdnf PE=1 SV=1
12	P39905	5.95e-18	80.1	211	0.259	0.242	GDNF_HUMAN Glial cell line-derived neurotrophic factor OS=Homo sapiens OX=9606 GN=GDNF PE=1 SV=1
13	Q99988	0.004	39.7	308	0.147	0.094	GDF15_HUMAN Growth/differentiation factor 15 OS=Homo sapiens OX=9606 GN=GDF15 PE=1 SV=3
14	P03971	0.040	36.6	560	0.208	0.073	MIS_HUMAN Muellerian-inhibiting factor OS=Homo sapiens OX=9606 GN=AMH PE=1 SV=3
15	Q9LS06	0.057	36.2	333	0.102	0.060	RAVL4_ARATH AP2/ERF and B3 domain-containing transcription factor ARF14 OS=Arabidopsis thaliana OX=3702 GN=ARF14 PE=2 SV=1
16	P27106	0.12	35.0	554	0.173	0.061	MIS_MOUSE Muellerian-inhibiting factor OS=Mus musculus OX=10090 GN=Amh PE=2 SV=2
17	P49000	0.13	35.0	553	0.168	0.060	MIS_RAT Muellerian-inhibiting factor OS=Rattus norvegicus OX=10116 GN=Amh PE=2 SV=1
18	P92172	0.16	34.7	350	0.152	0.086	DAF7_CAEEL Dauer larva development regulatory growth factor daf-7 OS=Caenorhabditis elegans OX=6239 GN=daf-7 PE=1 SV=1
19	Q03344	0.21	33.1	107	0.142	0.262	ATIF1_RAT ATPase inhibitor, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5if1 PE=3 SV=2
20	G7PWZ3	0.95	32.3	308	0.178	0.114	GDF15_MACFA Growth/differentiation factor 15 OS=Macaca fascicularis OX=9541 GN=GDF15 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00019 TGF_beta	2.3e-10	52.6	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302648

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000428518	0.999	GDNF family receptor alpha-2
2	9606.ENSP00000347591	0.996	GDNF family receptor alpha-1
3	9606.ENSP00000347942	0.991	Proto-oncogene tyrosine-protein kinase receptor Ret
4	9606.ENSP00000309591	0.901	cAMP-dependent protein kinase catalytic subunit alpha
5	9606.ENSP00000359719	0.901	cAMP-dependent protein kinase catalytic subunit beta
6	9606.ENSP00000366488	0.901	cAMP-dependent protein kinase catalytic subunit gamma
7	9606.ENSP00000274721	0.873	GDNF family receptor alpha-3
8	9606.ENSP00000313423	0.871	GDNF family receptor alpha-4
9	9606.ENSP00000431418	0.820	High affinity nerve growth factor receptor
10	9606.ENSP00000480132	0.752	Neural cell adhesion molecule 1
11	9606.ENSP00000432799	0.749	Mesencephalic astrocyte-derived neurotrophic factor
12	9606.ENSP00000362680	0.700	Proto-oncogene tyrosine-protein kinase Src
13	9606.ENSP00000358525	0.695	Beta-nerve growth factor
14	9606.ENSP00000419395	0.686	Cerebral dopamine neurotrophic factor
15	9606.ENSP00000397297	0.676	Neurotrophin-3
16	9606.ENSP00000343636	0.672	GDNF family receptor alpha like
17	9606.ENSP00000370571	0.668	Tyrosine 3-monooxygenase
18	9606.ENSP00000414303	0.667	Brain-derived neurotrophic factor
19	9606.ENSP00000403644	0.644	Aromatic-L-amino-acid decarboxylase
20	9606.ENSP00000469455	0.640	Neurotrophin-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0140677	0.908	molecular function activator activity
GO:0030546	0.732	signaling receptor activator activity
GO:0048018	0.724	receptor ligand activity
GO:0008083	0.379	growth factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007165	0.996	signal transduction
GO:0032501	0.992	multicellular organismal process
GO:0007167	0.982	enzyme-linked receptor protein signaling pathway
GO:0007399	0.976	nervous system development
GO:0007169	0.961	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0030154	0.531	cell differentiation
GO:0071840	0.363	cellular component organization or biogenesis
GO:0016043	0.332	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.998	cellular anatomical entity
GO:0005576	0.992	extracellular region
GO:0005829	0.500	cytosol
GO:0016020	0.492	membrane
GO:0120025	0.370	plasma membrane bounded cell projection
GO:0071944	0.319	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]