StarFunc result for job id Q99750

User Input

>input (246 residues)
MYQVSGQRPSGCDAPYGAPSAAPGPAQTLSLLPGLEVVTGSTHPAEAAPEEGSLEEAATP
MPQGNGPGIPQGLDSTDLDVPTEAVTCQPQGNPLGCTPLLPNDSGHPSELGGTRRAGNGA
LGGPKAHRKLQTHPSLASQGSKKSKSSSKSTTSQIPLQAQEDCCVHCILSCLFCEFLTLC
NIVLDCATCGSCSSEDSCLCCCCCGSGECADCDLPCDLDCGILDACCESADCLEICMECC
GLCFSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99750	0.999	0.999	3.434E-34	246	1.000	1.000	Q99750.pdb.gz	MDFI_HUMAN MyoD family inhibitor OS=Homo sapiens OX=9606 GN=MDFI PE=1 SV=1
2	AFDB:Q9P1T7	0.219	0.219	1.087E-9	246	0.411	0.411	Q9P1T7.pdb.gz	MDFIC_HUMAN MyoD family inhibitor domain-containing protein OS=Homo sapiens OX=9606 GN=MDFIC PE=1 SV=2
3	AFDB:Q98SK0	0.201	0.201	3.035E-9	246	0.402	0.402	Q98SK0.pdb.gz	MDFIC_XENLA MyoD family inhibitor domain-containing protein OS=Xenopus laevis OX=8355 GN=mdfic PE=2 SV=1
4	AFDB:Q8BX65	0.199	0.198	3.727E-9	247	0.378	0.377	Q8BX65.pdb.gz	MDFIC_MOUSE MyoD family inhibitor domain-containing protein OS=Mus musculus OX=10090 GN=Mdfic PE=1 SV=1
5	AFDB:Q5SXY1	0.100	0.031	2.704	1067	0.138	0.032	Q5SXY1.pdb.gz	CYTSB_MOUSE Cytospin-B OS=Mus musculus OX=10090 GN=Specc1 PE=1 SV=2
6	AFDB:Q67Y69	0.119	0.064	4.077	478	0.159	0.082	Q67Y69.pdb.gz	WDL7_ARATH Protein WVD2-like 7 OS=Arabidopsis thaliana OX=3702 GN=WDL7 PE=2 SV=1
7	AFDB:P18433	0.165	0.063	7.550	802	0.138	0.042	P18433.pdb.gz	PTPRA_HUMAN Receptor-type tyrosine-protein phosphatase alpha OS=Homo sapiens OX=9606 GN=PTPRA PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99750	9.05e-174	479	246	1.000	1.000	MDFI_HUMAN MyoD family inhibitor OS=Homo sapiens OX=9606 GN=MDFI PE=1 SV=1
2	P70331	9.19e-61	193	251	0.455	0.446	MDFI_MOUSE MyoD family inhibitor OS=Mus musculus OX=10090 GN=Mdfi PE=1 SV=1
3	Q9P1T7	1.87e-37	133	246	0.325	0.325	MDFIC_HUMAN MyoD family inhibitor domain-containing protein OS=Homo sapiens OX=9606 GN=MDFIC PE=1 SV=2
4	Q8BX65	1.58e-35	128	247	0.301	0.300	MDFIC_MOUSE MyoD family inhibitor domain-containing protein OS=Mus musculus OX=10090 GN=Mdfic PE=1 SV=1
5	Q98SK0	1.63e-34	125	246	0.313	0.313	MDFIC_XENLA MyoD family inhibitor domain-containing protein OS=Xenopus laevis OX=8355 GN=mdfic PE=2 SV=1
6	Q9JM99	0.72	33.5	1054	0.093	0.022	PRG4_MOUSE Proteoglycan 4 OS=Mus musculus OX=10090 GN=Prg4 PE=1 SV=2
7	Q9Y5B6	1.2	32.7	917	0.073	0.020	PAXB1_HUMAN PAX3- and PAX7-binding protein 1 OS=Homo sapiens OX=9606 GN=PAXBP1 PE=1 SV=2
8	Q8N9B5	1.6	32.3	988	0.077	0.019	JMY_HUMAN Junction-mediating and -regulatory protein OS=Homo sapiens OX=9606 GN=JMY PE=1 SV=2
9	R4I3J1	2.4	32.0	1245	0.077	0.015	R4I3J1_BACTU Crystaline entomocidal protoxin OS=Bacillus thuringiensis OX=1428 PE=3 SV=1
10	Q45712	2.5	32.0	1245	0.077	0.015	CR5BA_BACTU Pesticidal crystal protein Cry5Ba OS=Bacillus thuringiensis OX=1428 GN=cry5Ba PE=1 SV=1
11	Q92954	2.5	32.0	1404	0.081	0.014	PRG4_HUMAN Proteoglycan 4 OS=Homo sapiens OX=9606 GN=PRG4 PE=1 SV=3
12	P59764	3.1	31.6	1978	0.077	0.010	DOCK4_MOUSE Dedicator of cytokinesis protein 4 OS=Mus musculus OX=10090 GN=Dock4 PE=1 SV=1
13	Q8BRH4	3.1	31.6	4903	0.081	0.004	KMT2C_MOUSE Histone-lysine N-methyltransferase 2C OS=Mus musculus OX=10090 GN=Kmt2c PE=1 SV=2
14	Q9VFC0	3.2	31.6	632	0.065	0.025	SCC4_DROME MAU2 chromatid cohesion factor homolog OS=Drosophila melanogaster OX=7227 GN=Mau2 PE=2 SV=1
15	P21179	3.3	31.6	753	0.057	0.019	CATE_ECOLI Catalase HPII OS=Escherichia coli (strain K12) OX=83333 GN=katE PE=1 SV=1
16	Q9SK33	3.4	31.2	271	0.069	0.063	WRK60_ARATH Probable WRKY transcription factor 60 OS=Arabidopsis thaliana OX=3702 GN=WRKY60 PE=1 SV=1
17	G4SLH0	4.5	31.2	18562	0.163	0.002	TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans OX=6239 GN=ttn-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19337 BAMBI_C	3.1e+02	12.6	BMP and activin membrane-bound inhibitor homolog C-terminus
2	PF15316 MDFI	3.1e-49	178.8	MyoD family inhibitor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000230321

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344456	0.709	Catenin beta-1
2	9606.ENSP00000250003	0.702	Myoblast determination protein 1
3	9606.ENSP00000311165	0.685	Aquaporin-1
4	9606.ENSP00000446242	0.684	Mitochondrial dicarboxylate carrier
5	9606.ENSP00000282549	0.681	Homeobox protein OTX1
6	9606.ENSP00000386895	0.664	Protein FAM124B
7	9606.ENSP00000261900	0.644	Cyclin-T1
8	9606.ENSP00000380524	0.641	Calcyphosin-like protein
9	9606.ENSP00000359674	0.635	Uncharacterized protein C10orf62
10	9606.ENSP00000320318	0.632	Sialidase-4
11	9606.ENSP00000435421	0.511	DNA damage-induced apoptosis suppressor protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0098772	0.997	molecular function regulator activity
GO:0042802	0.995	identical protein binding
GO:0140416	0.986	transcription regulator inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019222	0.999	regulation of metabolic process
GO:0009987	0.993	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0060255	0.983	regulation of macromolecule metabolic process
GO:0051171	0.981	regulation of nitrogen compound metabolic process
GO:0031323	0.975	regulation of cellular metabolic process
GO:0065009	0.967	regulation of molecular function
GO:0009889	0.966	regulation of biosynthetic process
GO:0051179	0.964	localization
GO:0006355	0.951	regulation of DNA-templated transcription
GO:0044092	0.928	negative regulation of molecular function
GO:0051090	0.803	regulation of DNA-binding transcription factor activity
GO:0051235	0.709	maintenance of location
GO:0033036	0.609	macromolecule localization
GO:0051641	0.608	cellular localization
GO:0008104	0.598	protein localization
GO:0045185	0.593	maintenance of protein location
GO:0048518	0.405	positive regulation of biological process
GO:0048522	0.337	positive regulation of cellular process
GO:0043433	0.309	negative regulation of DNA-binding transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.956	nucleus
GO:0070013	0.951	intracellular organelle lumen
GO:0031981	0.896	nuclear lumen
GO:0043228	0.557	non-membrane-bounded organelle
GO:0043232	0.543	intracellular non-membrane-bounded organelle
GO:0005654	0.387	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]