StarFunc result for job id Q99755

User Input

>input (562 residues)
MASASSGPSSSVGFSSFDPAVPSCTLSSAASGIKRPMASEVLEARQDSYISLVPYASGMP
IKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIF
FPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELCSSGASG
SLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIR
IVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADM
YNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHAQREPLSSETQYSVDTRRPAPQKALY
STAMESIQGEARRGGTMETDDHMGGIPARNSKGERLLLYIGIIDILQSYRFVKKLEHSWK
ALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPSKKFRSGSSFSRRAGSSGNSC
ITYQPSVSGEHKAQVTTKAEVEPGVHLGRPDVLPQTPPLEEISEGSPIPDPSFSPLVGET
LQMLTTSTTLEKLEVAESEFTH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99755	1.000	1.000	1.052E-98	562	1.000	1.000	Q99755.pdb.gz	PI51A_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Homo sapiens OX=9606 GN=PIP5K1A PE=1 SV=1
2	AFDB:A0A2R8QMJ9	0.724	0.689	3.558E-68	592	0.642	0.610	A0A2R8QMJ9.pdb.gz
3	AFDB:O60331	0.684	0.579	3.967E-68	668	0.630	0.530	O60331.pdb.gz	PI51C_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma OS=Homo sapiens OX=9606 GN=PIP5K1C PE=1 SV=2
4	AFDB:Q503I3	0.675	0.679	9.538E-66	559	0.582	0.585	Q503I3.pdb.gz	Q503I3_DANRE Phosphatidylinositol-4-phosphate 5-kinase type-1 gamma OS=Danio rerio OX=7955 GN=pip5k1a PE=1 SV=1
5	AFDB:A0A0B4K7M0	0.660	0.495	9.796E-60	756	0.537	0.399	A0A0B4K7M0.pdb.gz	A0A0B4K7M0_DROME Phosphatidylinositol 4-phosphate 5-kinase 59B, isoform H OS=Drosophila melanogaster OX=7227 GN=PIP5K59B PE=1 SV=1
6	AFDB:O14986	0.670	0.697	1.067E-58	540	0.552	0.574	O14986.pdb.gz	PI51B_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Homo sapiens OX=9606 GN=PIP5K1B PE=1 SV=2
7	AFDB:Q0E8Y1	0.661	0.479	1.127E-58	781	0.518	0.373	Q0E8Y1.pdb.gz	Q0E8Y1_DROME Phosphatidylinositol 4-phosphate 5-kinase 59B, isoform I OS=Drosophila melanogaster OX=7227 GN=PIP5K59B PE=1 SV=3
8	AFDB:Q9W2R3	0.658	0.473	2.231E-57	792	0.484	0.343	Q9W2R3.pdb.gz	Q9W2R3_DROME LP03320p OS=Drosophila melanogaster OX=7227 GN=sktl PE=1 SV=2
9	AFDB:Q7JNK2	0.474	0.574	6.421E-39	462	0.345	0.420	Q7JNK2.pdb.gz	Q7JNK2_DROME Putative phosphatidyl-inositol-4-phosphate 5-kinase OS=Drosophila melanogaster OX=7227 GN=sktl PE=4 SV=1
10	AFDB:Q9SFB8	0.516	0.412	2.482E-33	715	0.256	0.201	Q9SFB8.pdb.gz	PI5K6_ARATH Phosphatidylinositol 4-phosphate 5-kinase 6 OS=Arabidopsis thaliana OX=3702 GN=PIP5K6 PE=2 SV=1
11	PDB:1bo1A	0.499	0.834	1.182E-25	326	0.196	0.337	1bo1A.pdb.gz
12	PDB:6ym4A	0.485	0.825	1.392E-25	322	0.169	0.295	6ym4A.pdb.gz	Discovery and Characterization of the Potent and Highly Selective 1,7-Naphthyridine-Based Inhibitors BAY-091 and BAY-297 of the Kinase PIP4K2A.
13	PDB:7em5B	0.452	0.830	1.652E-23	297	0.178	0.337	7em5B.pdb.gz	The GTP responsiveness of PI5P4K beta evolved from a compromised trade-off between activity and specificity.
14	PDB:7n81B	0.463	0.823	2.717E-21	307	0.171	0.313	7n81B.pdb.gz	Pharmacological inhibition of PI5P4K alpha / beta disrupts cell energy metabolism and selectively kills p53-null tumor cells.
15	PDB:2gk9B	0.407	0.889	2.297E-16	250	0.157	0.352	2gk9B.pdb.gz
16	PDB:6fadC	0.176	0.258	6.152E-2	359	0.036	0.056	6fadC.pdb.gz	Molecular Mechanism of SR Protein Kinase 1 Inhibition by the Herpes Virus Protein ICP27.
17	PDB:2bujA	0.119	0.204	9.498E-2	291	0.028	0.055	2bujA.pdb.gz	Crystal Structure of the Human Serine-Threonine Kinase 16 in Complex with Staurosporine
18	PDB:2rsvA	0.157	0.205	1.246E-1	403	0.034	0.047	2rsvA.pdb.gz
19	PDB:4yc3A	0.148	0.245	1.389E-1	295	0.034	0.064	4yc3A.pdb.gz
20	PDB:6lk5A	0.145	0.271	1.635E-1	265	0.039	0.083	6lk5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4K7E3	0.0	545	777	0.470	0.340	A0A0B4K7E3_DROME Phosphatidylinositol 4-phosphate 5-kinase 59B, isoform F OS=Drosophila melanogaster OX=7227 GN=PIP5K59B PE=1 SV=1
2	A0A0B4K7M0	0.0	550	756	0.493	0.366	A0A0B4K7M0_DROME Phosphatidylinositol 4-phosphate 5-kinase 59B, isoform H OS=Drosophila melanogaster OX=7227 GN=PIP5K59B PE=1 SV=1
3	A2VD51	0.0	692	584	0.619	0.596	A2VD51_DANRE Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Danio rerio OX=7955 GN=zgc:158838 PE=1 SV=1
4	A6PW57	0.0	1130	550	0.979	1.000	A6PW57_HUMAN Phosphatidylinositol-4-phosphate 5-kinase type 1 alpha OS=Homo sapiens OX=9606 GN=PIP5K1A PE=1 SV=2
5	D3ZSI8	0.0	1005	546	0.868	0.894	PI51A_RAT Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Rattus norvegicus OX=10116 GN=Pip5k1a PE=1 SV=1
6	O14986	0.0	625	540	0.560	0.583	PI51B_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Homo sapiens OX=9606 GN=PIP5K1B PE=1 SV=2
7	O60331	0.0	670	668	0.600	0.504	PI51C_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma OS=Homo sapiens OX=9606 GN=PIP5K1C PE=1 SV=2
8	O70161	0.0	669	661	0.614	0.522	PI51C_MOUSE Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma OS=Mus musculus OX=10090 GN=Pip5k1c PE=1 SV=2
9	P70181	0.0	628	539	0.560	0.584	PI51B_MOUSE Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Mus musculus OX=10090 GN=Pip5k1b PE=1 SV=1
10	P70182	0.0	984	546	0.842	0.866	PI51A_MOUSE Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Mus musculus OX=10090 GN=Pip5k1a PE=1 SV=2
11	Q0E8Y1	0.0	545	781	0.466	0.335	Q0E8Y1_DROME Phosphatidylinositol 4-phosphate 5-kinase 59B, isoform I OS=Drosophila melanogaster OX=7227 GN=PIP5K59B PE=1 SV=3
12	Q503I3	0.0	648	559	0.580	0.583	Q503I3_DANRE Phosphatidylinositol-4-phosphate 5-kinase type-1 gamma OS=Danio rerio OX=7955 GN=pip5k1a PE=1 SV=1
13	Q5I6B8	0.0	667	688	0.612	0.500	PI51C_RAT Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma OS=Rattus norvegicus OX=10116 GN=Pip5k1c PE=1 SV=1
14	Q8T0K5	0.0	546	729	0.491	0.379	Q8T0K5_DROME GH26019p OS=Drosophila melanogaster OX=7227 GN=PIP5K59B PE=2 SV=1
15	Q99755	0.0	1162	562	1.000	1.000	PI51A_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Homo sapiens OX=9606 GN=PIP5K1A PE=1 SV=1
16	Q9W1Y2	0.0	550	729	0.493	0.380	Q9W1Y2_DROME FI05352p OS=Drosophila melanogaster OX=7227 GN=PIP5K59B PE=1 SV=2
17	Q9W1Y3	0.0	545	750	0.470	0.352	Q9W1Y3_DROME Phosphatidylinositol 4-phosphate 5-kinase 59B, isoform E OS=Drosophila melanogaster OX=7227 GN=PIP5K59B PE=1 SV=3
18	O01759	3.61e-173	505	611	0.425	0.391	O01759_CAEEL PIPK domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ppk-1 PE=1 SV=2
19	Q94544	8.36e-171	502	700	0.452	0.363	Q94544_DROME Phosphatidylinositol 4-phosphate 5-kinase OS=Drosophila melanogaster OX=7227 GN=sktl PE=2 SV=2
20	Q9W2R3	8.75e-171	505	792	0.456	0.323	Q9W2R3_DROME LP03320p OS=Drosophila melanogaster OX=7227 GN=sktl PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01504 PIP5K	2.8e-87	304.1	Phosphatidylinositol-4-phosphate 5-Kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357883

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357869	0.971	Phosphatidylinositol 4-kinase beta
2	9606.ENSP00000466363	0.967	Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma
3	9606.ENSP00000255882	0.960	Phosphatidylinositol 4-kinase alpha
4	9606.ENSP00000366563	0.958	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
5	9606.ENSP00000298316	0.957	ADP-ribosylation factor 6
6	9606.ENSP00000359665	0.948	Phosphatidylinositol 4-kinase type 2-alpha
7	9606.ENSP00000373713	0.948	Phosphatidylinositide phosphatase SAC1
8	9606.ENSP00000354519	0.940	Phosphatidylinositide phosphatase SAC2
9	9606.ENSP00000388631	0.940	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4
10	9606.ENSP00000316029	0.939	Talin-1
11	9606.ENSP00000367762	0.936	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
12	9606.ENSP00000440005	0.936	ADP-ribosylation factor 1
13	9606.ENSP00000430344	0.935	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1
14	9606.ENSP00000338185	0.934	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
15	9606.ENSP00000345988	0.933	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1
16	9606.ENSP00000383118	0.932	Cell division control protein 42 homolog
17	9606.ENSP00000400175	0.931	Transforming protein RhoA
18	9606.ENSP00000289153	0.930	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
19	9606.ENSP00000348461	0.930	Ras-related C3 botulinum toxin substrate 1
20	9606.ENSP00000360431	0.930	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0016308	0.999	1-phosphatidylinositol-4-phosphate 5-kinase activity
GO:0019899	0.621	enzyme binding
GO:0052742	0.426	phosphatidylinositol kinase activity
GO:0052813	0.368	phosphatidylinositol bisphosphate kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0006629	0.977	lipid metabolic process
GO:0046488	0.973	phosphatidylinositol metabolic process
GO:0008654	0.938	phospholipid biosynthetic process
GO:0046474	0.930	glycerophospholipid biosynthetic process
GO:0006661	0.903	phosphatidylinositol biosynthetic process
GO:0065007	0.757	biological regulation
GO:0050789	0.703	regulation of biological process
GO:0050794	0.693	regulation of cellular process
GO:0051179	0.449	localization
GO:0050896	0.344	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005886	0.998	plasma membrane
GO:0031981	0.995	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0042995	0.788	cell projection
GO:0120025	0.736	plasma membrane bounded cell projection
GO:0098590	0.727	plasma membrane region
GO:0031253	0.334	cell projection membrane
GO:0031252	0.332	cell leading edge

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14425	0.999	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ADP + H(+)
EC:2.7.1.68	0.999	1-phosphatidylinositol-4-phosphate 5-kinase.

[back to server]