StarFunc result for job id Q99758

User Input

>input (1704 residues)
MAVLRQLALLLWKNYTLQKRKVLVTVLELFLPLLFSGILIWLRLKIQSENVPNATIYPGQ
SIQELPLFFTFPPPGDTWELAYIPSHSDAAKTVTETVRRALVINMRVRGFPSEKDFEDYI
RYDNCSSSVLAAVVFEHPFNHSKEPLPLAVKYHLRFSYTRRNYMWTQTGSFFLKETEGWH
TTSLFPLFPNPGPREPTSPDGGEPGYIREGFLAVQHAVDRAIMEYHADAATRQLFQRLTV
TIKRFPYPPFIADPFLVAIQYQLPLLLLLSFTYTALTIARAVVQEKERRLKEYMRMMGLS
SWLHWSAWFLLFFLFLLIAASFMTLLFCVKVKPNVAVLSRSDPSLVLAFLLCFAISTISF
SFMVSTFFSKANMAAAFGGFLYFFTYIPYFFVAPRYNWMTLSQKLCSCLLSNVAMAMGAQ
LIGKFEAKGMGIQWRDLLSPVNVDDDFCFGQVLGMLLLDSVLYGLVTWYMEAVFPGQFGV
PQPWYFFIMPSYWCGKPRAVAGKEEEDSDPEKALRNEYFEAEPEDLVAGIKIKHLSKVFR
VGNKDRAAVRDLNLNLYEGQITVLLGHNGAGKTTTLSMLTGLFPPTSGRAYISGYEISQD
MVQIRKSLGLCPQHDILFDNLTVAEHLYFYAQLKGLSRQKCPEEVKQMLHIIGLEDKWNS
RSRFLSGGMRRKLSIGIALIAGSKVLILDEPTSGMDAISRRAIWDLLQRQKSDRTIVLTT
HFMDEADLLGDRIAIMAKGELQCCGSSLFLKQKYGAGYHMTLVKEPHCNPEDISQLVHHH
VPNATLESSAGAELSFILPRESTHRFEGLFAKLEKKQKELGIASFGASITTMEEVFLRVG
KLVDSSMDIQAIQLPALQYQHERRASDWAVDSNLCGAMDPSDGIGALIEEERTAVKLNTG
LALHCQQFWAMFLKKAAYSWREWKMVAAQVLVPLTCVTLALLAINYSSELFDDPMLRLTL
GEYGRTVVPFSVPGTSQLGQQLSEHLKDALQAEGQEPREVLGDLEEFLIFRASVEGGGFN
ERCLVAASFRDVGERTVVNALFNNQAYHSPATALAVVDNLLFKLLCGPHASIVVSNFPQP
RSALQAAKDQFNEGRKGFDIALNLLFAMAFLASTFSILAVSERAVQAKHVQFVSGVHVAS
FWLSALLWDLISFLIPSLLLLVVFKAFDVRAFTRDGHMADTLLLLLLYGWAIIPLMYLMN
FFFLGAATAYTRLTIFNILSGIATFLMVTIMRIPAVKLEELSKTLDHVFLVLPNHCLGMA
VSSFYENYETRRYCTSSEVAAHYCKKYNIQYQENFYAWSAPGVGRFVASMAASGCAYLIL
LFLIETNLLQRLRGILCALRRRRTLTELYTRMPVLPEDQDVADERTRILAPSPDSLLHTP
LIIKELSKVYEQRVPLLAVDRLSLAVQKGECFGLLGFNGAGKTTTFKMLTGEESLTSGDA
FVGGHRISSDVGKVRQRIGYCPQFDALLDHMTGREMLVMYARLRGIPERHIGACVENTLR
GLLLEPHANKLVRTYSGGNKRKLSTGIALIGEPAVIFLDEPSTGMDPVARRLLWDTVARA
RESGKAIIITSHSMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSLRAKVQSEGQ
QEALEEFKAFVDLTFPGSVLEDEHQGMVHYHLPGRDLSWAKVFGILEKAKEKYGVDDYSV
SQISLEQVFLSFAHLQPPTAEEGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7w01A	0.774	0.819	0.000	1598	0.935	0.997	7w01A.pdb.gz
2	PDB:7w02A	0.883	0.959	0.000	1566	0.914	0.995	7w02A.pdb.gz	Cryo-EM structures of the human surfactant lipid transporter ABCA3.
3	AFDB:A0A0G2K1Q8	0.998	0.998	0.000	1704	0.880	0.880	A0A0G2K1Q8.pdb.gz	ABCA3_RAT Phospholipid-transporting ATPase ABCA3 OS=Rattus norvegicus OX=10116 GN=Abca3 PE=1 SV=1
4	AFDB:B8A446	0.744	0.570	0.000	2268	0.354	0.266	B8A446.pdb.gz	B8A446_DANRE ATP-binding cassette sub-family A member 1 OS=Danio rerio OX=7955 GN=abca1 PE=4 SV=1
5	AFDB:E9PWH4	0.917	0.936	0.000	1668	0.469	0.480	E9PWH4.pdb.gz	E9PWH4_MOUSE ATP-binding cassette, sub-family A (ABC1), member 15 OS=Mus musculus OX=10090 GN=Abca15 PE=1 SV=1
6	AFDB:E9PX95	0.938	0.923	0.000	1733	0.539	0.530	E9PX95.pdb.gz	ABCAH_MOUSE ATP-binding cassette sub-family A member 17 OS=Mus musculus OX=10090 GN=Abca17 PE=1 SV=1
7	AFDB:E9Q876	0.782	0.527	0.000	2595	0.305	0.200	E9Q876.pdb.gz	ABCAC_MOUSE Glucosylceramide transporter ABCA12 OS=Mus musculus OX=10090 GN=Abca12 PE=1 SV=1
8	AFDB:O35600	0.723	0.547	0.000	2310	0.347	0.256	O35600.pdb.gz	ABCA4_MOUSE Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Mus musculus OX=10090 GN=Abca4 PE=1 SV=1
9	AFDB:O95477	0.809	0.616	0.000	2261	0.354	0.267	O95477.pdb.gz	ABCA1_HUMAN Phospholipid-transporting ATPase ABCA1 OS=Homo sapiens OX=9606 GN=ABCA1 PE=1 SV=3
10	AFDB:P78363	0.733	0.562	0.000	2273	0.347	0.260	P78363.pdb.gz	ABCA4_HUMAN Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Homo sapiens OX=9606 GN=ABCA4 PE=1 SV=3
11	AFDB:Q7TNJ2	0.737	0.590	0.000	2170	0.342	0.269	Q7TNJ2.pdb.gz	ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus OX=10116 GN=Abca7 PE=1 SV=1
12	AFDB:Q84M24	0.820	0.746	0.000	1882	0.337	0.306	Q84M24.pdb.gz	AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana OX=3702 GN=ABCA1 PE=2 SV=2
13	PDB:7lkzA	0.812	0.725	1.804E-99	1920	0.355	0.315	7lkzA.pdb.gz	Molecular structures of the eukaryotic retinal importer ABCA4.
14	PDB:7tbwA	0.756	0.672	1.260E-98	1928	0.336	0.297	7tbwA.pdb.gz	Cholesterol efflux mechanism revealed by structural analysis of human ABCA1 conformational states.
15	PDB:7e7qA	0.736	0.645	3.713E-93	1958	0.321	0.279	7e7qA.pdb.gz	Structural basis of substrate recognition and translocation by human ABCA4.
16	PDB:7e7iA	0.647	0.559	9.418E-91	2011	0.323	0.273	7e7iA.pdb.gz
17	PDB:7tbyA	0.614	0.588	1.568E-86	1788	0.320	0.305	7tbyA.pdb.gz	Cholesterol efflux mechanism revealed by structural analysis of human ABCA1 conformational states.
18	PDB:7m1pA	0.638	0.568	3.234E-76	1938	0.302	0.266	7m1pA.pdb.gz
19	PDB:7roqA	0.567	0.531	2.856E-72	1831	0.286	0.267	7roqA.pdb.gz	Structure of the Human Lipid Exporter ABCA1.
20	PDB:7m1qA	0.594	0.536	1.061E-67	1911	0.285	0.254	7m1qA.pdb.gz	Cryo-EM structures of the ABCA4 importer reveal mechanisms underlying substrate binding and Stargardt disease.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K1Q8	0.0	3111	1704	0.876	0.876	ABCA3_RAT Phospholipid-transporting ATPase ABCA3 OS=Rattus norvegicus OX=10116 GN=Abca3 PE=1 SV=1
2	E9PWH4	0.0	1536	1668	0.475	0.486	E9PWH4_MOUSE ATP-binding cassette, sub-family A (ABC1), member 15 OS=Mus musculus OX=10090 GN=Abca15 PE=1 SV=1
3	E9PX95	0.0	1826	1733	0.543	0.534	ABCAH_MOUSE ATP-binding cassette sub-family A member 17 OS=Mus musculus OX=10090 GN=Abca17 PE=1 SV=1
4	Q54BT5	0.0	662	1702	0.282	0.283	ABCA3_DICDI ABC transporter A family member 3 OS=Dictyostelium discoideum OX=44689 GN=abcA3 PE=3 SV=1
5	Q555Z5	0.0	631	1615	0.276	0.291	ABCA4_DICDI ABC transporter A family member 4 OS=Dictyostelium discoideum OX=44689 GN=abcA4 PE=3 SV=1
6	Q5SSE9	0.0	749	5034	0.310	0.105	ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus OX=10090 GN=Abca13 PE=1 SV=1
7	Q6XBG2	0.0	1539	1668	0.476	0.486	Q6XBG2_MOUSE ATP-binding cassette transporter sub-family A member 15 OS=Mus musculus OX=10090 GN=Abca15 PE=1 SV=1
8	Q84M24	0.0	758	1882	0.346	0.313	AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana OX=3702 GN=ABCA1 PE=2 SV=2
9	Q8R420	0.0	3091	1704	0.881	0.881	ABCA3_MOUSE Phospholipid-transporting ATPase ABCA3 OS=Mus musculus OX=10090 GN=Abca3 PE=1 SV=3
10	Q8T6J1	0.0	606	1631	0.270	0.282	ABCA6_DICDI ABC transporter A family member 6 OS=Dictyostelium discoideum OX=44689 GN=abcA6 PE=3 SV=1
11	Q8T6J2	0.0	612	1662	0.272	0.279	ABCA5_DICDI ABC transporter A family member 5 OS=Dictyostelium discoideum OX=44689 GN=abcA5 PE=3 SV=1
12	Q99758	0.0	3521	1704	1.000	1.000	ABCA3_HUMAN Phospholipid-transporting ATPase ABCA3 OS=Homo sapiens OX=9606 GN=ABCA3 PE=1 SV=2
13	Q385F7	2.72e-179	588	1738	0.271	0.266	Q385F7_TRYB2 ABC transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3950 PE=4 SV=1
14	C0P274	5.07e-177	582	1758	0.289	0.280	C0P274_CAEEL ABC transporter domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ced-7 PE=1 SV=1
15	P34358	2.35e-175	577	1704	0.289	0.289	CED7_CAEEL ABC transporter ced-7 OS=Caenorhabditis elegans OX=6239 GN=ced-7 PE=1 SV=6
16	Q0E8Q7	2.24e-174	572	1597	0.283	0.302	Q0E8Q7_DROME Engulfment ABC transporter in the ovary, isoform B OS=Drosophila melanogaster OX=7227 GN=Eato PE=1 SV=1
17	P41233	8.42e-165	556	2261	0.194	0.146	ABCA1_MOUSE Phospholipid-transporting ATPase ABCA1 OS=Mus musculus OX=10090 GN=Abca1 PE=1 SV=4
18	B8A446	1.25e-164	555	2268	0.195	0.147	B8A446_DANRE ATP-binding cassette sub-family A member 1 OS=Danio rerio OX=7955 GN=abca1 PE=4 SV=1
19	O95477	1.52e-164	555	2261	0.192	0.145	ABCA1_HUMAN Phospholipid-transporting ATPase ABCA1 OS=Homo sapiens OX=9606 GN=ABCA1 PE=1 SV=3
20	K9J4V5	3.13e-164	554	2262	0.190	0.143	K9J4V5_PIG ATP-binding cassette sub-family A member 1 OS=Sus scrofa OX=9823 GN=ABCA1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13175 AAA_15	0.52	21.4	AAA ATPase domain
2	PF13304 AAA_21	1.8e-13	62.5	AAA domain, putative AbiEii toxin, Type IV TA system
3	PF13401 AAA_22	1.1e+02	14.5	AAA domain
4	PF13476 AAA_23	0.36	22.9	AAA domain
5	PF13555 AAA_29	28	15.9	P-loop containing region of AAA domain
6	PF13604 AAA_30	55	14.9	AAA domain
7	PF12698 ABC2_membrane_3	3e-50	182.9	ABC-2 family transporter protein
8	PF00005 ABC_tran	1.8e-48	176.0	ABC transporter
9	PF00025 Arf	6.7e+02	11.1	ADP-ribosylation factor family
10	PF13732 DUF4162	5.7	19.0	Domain of unknown function (DUF4162)
11	PF01926 MMR_HSR1	2.6e+02	13.1	50S ribosome-binding GTPase
12	PF03193 RsgA_GTPase	3.9	18.8	RsgA GTPase
13	PF02463 SMC_N	6.5e+02	11.1	RecF/RecN/SMC N terminal domain
14	PF00448 SRP54	1.3e+02	13.7	SRP54-type protein, GTPase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301732

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360108	0.844	Putative tyrosine-protein phosphatase auxilin
2	9606.ENSP00000248114	0.838	FAD-linked sulfhydryl oxidase ALR
3	9606.ENSP00000316152	0.834	Pulmonary surfactant-associated protein C
4	9606.ENSP00000386346	0.830	Pulmonary surfactant-associated protein B
5	9606.ENSP00000454646	0.826	Putative sodium-coupled neutral amino acid transporter 7
6	9606.ENSP00000380019	0.824	Zinc finger protein 384
7	9606.ENSP00000325674	0.822	Exocyst complex component 3-like protein
8	9606.ENSP00000385722	0.822	Integrator complex subunit 1
9	9606.ENSP00000371211	0.819	Transmembrane protease serine 6
10	9606.ENSP00000265107	0.817	WD repeat-containing protein 70
11	9606.ENSP00000265806	0.817	R3H domain and coiled-coil containing 1
12	9606.ENSP00000309430	0.817	GPI transamidase component PIG-S
13	9606.ENSP00000312250	0.817	ADP-dependent glucokinase
14	9606.ENSP00000367823	0.817	Protein FAM214B
15	9606.ENSP00000380659	0.817	Eukaryotic translation initiation factor 4E transporter
16	9606.ENSP00000380793	0.817	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
17	9606.ENSP00000482968	0.817	Alstrom syndrome protein 1
18	9606.ENSP00000380690	0.761	BICD family-like cargo adapter 1
19	9606.ENSP00000361400	0.755	Pulmonary surfactant-associated protein A2
20	9606.ENSP00000355094	0.740	Protein quaking

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016887	0.996	ATP hydrolysis activity
GO:0008559	0.996	ABC-type xenobiotic transporter activity
GO:0008525	0.995	phosphatidylcholine transporter activity
GO:0120014	0.995	phospholipid transfer activity
GO:0140333	0.995	glycerophospholipid flippase activity
GO:0005488	0.981	binding
GO:0005515	0.959	protein binding
GO:0097159	0.878	organic cyclic compound binding
GO:1901363	0.850	heterocyclic compound binding
GO:0017076	0.640	purine nucleotide binding
GO:0035639	0.629	purine ribonucleoside triphosphate binding
GO:0032555	0.622	purine ribonucleotide binding
GO:0120019	0.472	phosphatidylcholine transfer activity
GO:0140345	0.470	phosphatidylcholine flippase activity
GO:0005524	0.363	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0071704	0.977	organic substance metabolic process
GO:0044238	0.974	primary metabolic process
GO:0044237	0.971	cellular metabolic process
GO:0065007	0.970	biological regulation
GO:0050789	0.964	regulation of biological process
GO:0050896	0.861	response to stimulus
GO:0051179	0.837	localization
GO:0050794	0.803	regulation of cellular process
GO:0019222	0.776	regulation of metabolic process
GO:0042221	0.679	response to chemical
GO:0006807	0.669	nitrogen compound metabolic process
GO:0006810	0.646	transport
GO:0006629	0.626	lipid metabolic process
GO:0006650	0.597	glycerophospholipid metabolic process
GO:1905952	0.592	regulation of lipid localization
GO:0080090	0.590	regulation of primary metabolic process
GO:1901564	0.569	organonitrogen compound metabolic process
GO:0071702	0.533	organic substance transport
GO:0048518	0.526	positive regulation of biological process
GO:0033036	0.497	macromolecule localization
GO:0032368	0.485	regulation of lipid transport
GO:0019216	0.436	regulation of lipid metabolic process
GO:0010876	0.380	lipid localization
GO:0055085	0.366	transmembrane transport
GO:0015748	0.340	organophosphate ester transport
GO:0043170	0.322	macromolecule metabolic process
GO:0032501	0.307	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0031090	1.000	organelle membrane
GO:0031410	0.998	cytoplasmic vesicle
GO:0098588	0.977	bounding membrane of organelle
GO:0012506	0.975	vesicle membrane
GO:0042599	0.969	lamellar body
GO:0030659	0.963	cytoplasmic vesicle membrane
GO:0030667	0.927	secretory granule membrane
GO:0005886	0.782	plasma membrane
GO:0005783	0.304	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13065	0.996	ATP + H2O = ADP + H(+) + phosphate
EC:7.6.2.2	0.996	ABC-type xenobiotic transporter.
EC:7.6.2.1	0.995	P-type phospholipid transporter.

[back to server]