StarFunc result for job id Q99759

User Input

>input (626 residues)
MDEQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQSDVRIKFEHNGERRIIAF
SRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILL
LSQDRNHNSSSPHSGVSRQVRIKASQSAGDINTIYQPPEPRSRHLSVSSQNPGRSSPPPG
YVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLSSAENSLSGSCQSLDRSADSPSF
RKSRMSRAQSFPDNRQEYSDRETQLYDKGVKGGTYPRRYHVSVHHKDYSDGRRTFPRIRR
HQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRLRSADSENALSVQERNVPTKSPSAPI
NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQ
HERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYL
HSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVIS
GEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFL
RRIFVEARQRPSAEELLTHHFAQLMY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7EXX1	0.570	0.570	4.171E-84	626	0.776	0.776	E7EXX1.pdb.gz
2	AFDB:A0A024RAH0	0.465	0.470	7.276E-73	619	0.655	0.662	A0A024RAH0.pdb.gz
3	AFDB:Q9CAD5	0.373	0.267	1.051E-27	883	0.278	0.197	Q9CAD5.pdb.gz	YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana OX=3702 GN=YDA PE=1 SV=1
4	AFDB:Q10407	0.377	0.216	1.409E-21	1116	0.284	0.159	Q10407.pdb.gz	MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mkh1 PE=3 SV=1
5	AFDB:Q9VXE5	0.365	0.358	8.334E-21	639	0.228	0.224	Q9VXE5.pdb.gz	PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster OX=7227 GN=mbt PE=1 SV=2
6	AFDB:Q8C015	0.362	0.317	2.676E-20	719	0.233	0.203	Q8C015.pdb.gz	PAK5_MOUSE Serine/threonine-protein kinase PAK 5 OS=Mus musculus OX=10090 GN=Pak5 PE=1 SV=1
7	AFDB:F1QZR2	0.356	0.338	5.211E-20	664	0.222	0.209	F1QZR2.pdb.gz	F1QZR2_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=im:5916170 PE=1 SV=1
8	PDB:3eqdA	0.378	0.732	7.681E-20	315	0.128	0.254	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
9	AFDB:Q3ULB5	0.358	0.330	9.600E-20	682	0.214	0.196	Q3ULB5.pdb.gz	PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus OX=10090 GN=Pak6 PE=2 SV=1
10	AFDB:B7Z0W0	0.365	0.276	2.843E-18	840	0.204	0.152	B7Z0W0.pdb.gz	B7Z0W0_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Pak PE=4 SV=2
11	AFDB:Q5A6T5	0.380	0.403	3.177E-18	589	0.193	0.205	Q5A6T5.pdb.gz	STE7_CANAL Serine/threonine-protein kinase STE7 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HST7 PE=3 SV=2
12	PDB:4d28C	0.357	0.761	9.122E-18	279	0.117	0.262	4d28C.pdb.gz
13	PDB:6s73A	0.369	0.823	1.590E-17	269	0.134	0.312	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
14	PDB:4c0tA	0.363	0.750	2.099E-17	291	0.115	0.247	4c0tA.pdb.gz
15	PDB:4eomC	0.350	0.754	2.099E-17	276	0.112	0.254	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
16	PDB:7myjC	0.360	0.477	2.345E-17	465	0.117	0.157	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
17	PDB:5ufuA	0.364	0.599	5.395E-17	369	0.121	0.206	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
18	PDB:4rerA	0.365	0.491	5.704E-17	459	0.126	0.172	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
19	PDB:6b1uA	0.361	0.501	7.530E-17	442	0.112	0.158	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
20	PDB:4mk0A	0.356	0.354	8.414E-17	631	0.110	0.109	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1M9D0	0.0	817	619	0.661	0.669	F1M9D0_RAT Mitogen activated protein kinase kinase kinase 2 OS=Rattus norvegicus OX=10116 GN=Map3k2 PE=1 SV=2
2	Q61083	0.0	809	619	0.655	0.662	M3K2_MOUSE Mitogen-activated protein kinase kinase kinase 2 OS=Mus musculus OX=10090 GN=Map3k2 PE=1 SV=2
3	Q61084	0.0	1263	626	0.966	0.966	M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus OX=10090 GN=Map3k3 PE=1 SV=1
4	Q99759	0.0	1306	626	1.000	1.000	M3K3_HUMAN Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP3K3 PE=1 SV=2
5	Q9Y2U5	0.0	812	619	0.655	0.662	M3K2_HUMAN Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2
6	X1WGZ3	0.0	993	620	0.778	0.785	X1WGZ3_DANRE Mitogen-activated protein kinase kinase kinase 3 OS=Danio rerio OX=7955 GN=map3k3 PE=4 SV=1
7	Q9FZ36	1.41e-79	266	651	0.206	0.198	M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana OX=3702 GN=ANP2 PE=2 SV=1
8	O22040	5.26e-79	265	666	0.206	0.194	ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana OX=3702 GN=ANP1 PE=1 SV=2
9	Q40541	1.41e-76	259	690	0.208	0.188	NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum OX=4097 GN=NPK1 PE=1 SV=1
10	F4HRJ4	8.09e-76	255	609	0.203	0.209	M3K3A_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana OX=3702 GN=MAPKKK3 PE=1 SV=1
11	O22042	1.21e-75	256	651	0.206	0.198	M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana OX=3702 GN=ANP3 PE=1 SV=1
12	Q54R82	3.24e-72	252	942	0.192	0.127	MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum OX=44689 GN=mkkA PE=1 SV=2
13	Q9C5H5	4.36e-71	245	716	0.201	0.176	M3K5G_ARATH Mitogen-activated protein kinase kinase kinase 5 OS=Arabidopsis thaliana OX=3702 GN=MAPKKK5 PE=1 SV=1
14	Q9CAD5	9.24e-71	247	883	0.188	0.134	YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana OX=3702 GN=YDA PE=1 SV=1
15	Q6FXI1	3.80e-68	236	676	0.206	0.191	Q6FXI1_CANGA Candida glabrata strain CBS138 chromosome B complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=STE11 PE=3 SV=1
16	P28829	1.50e-67	234	659	0.193	0.184	BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=byr2 PE=1 SV=1
17	Q389U2	1.41e-66	230	606	0.192	0.198	Q389U2_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.406.0580 PE=4 SV=1
18	P23561	2.46e-66	232	717	0.204	0.179	STE11_YEAST Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STE11 PE=1 SV=3
19	C8V9T1	4.24e-63	229	1558	0.198	0.080	C8V9T1_EMENI Mitogen-activated protein (MAP) kinase kinase kinase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04887 PE=4 SV=1
20	G5EB26	1.34e-61	222	886	0.181	0.128	G5EB26_EMENI MAPKK kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02269 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.13	22.9	ABC1 atypical kinase-like domain
2	PF13095 FTA2	2.1e+02	13.0	Kinetochore Sim4 complex subunit FTA2
3	PF14531 Kinase-like	0.22	22.4	Kinase-like
4	PF00564 PB1	4.4e-09	47.5	PB1 domain
5	PF00069 Pkinase	1.8e-64	229.3	Protein kinase domain
6	PF07714 PK_Tyr_Ser-Thr	1.8e-37	140.6	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000000237

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000009554	0.995	Belongs to the protein kinase superfamily.
2	60711.ENSCSAP00000011794	0.993	CCM2 scaffolding protein
3	60711.ENSCSAP00000001791	0.969	TNF receptor-associated factor 6, E3 ubiquitin protein ligase
4	60711.ENSCSAP00000003013	0.966	Inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma
5	60711.ENSCSAP00000011145	0.948	Inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta
6	60711.ENSCSAP00000001972	0.946	Conserved helix-loop-helix ubiquitous kinase
7	60711.ENSCSAP00000003922	0.942	Belongs to the protein kinase superfamily.
8	60711.ENSCSAP00000000721	0.924	Belongs to the protein kinase superfamily.
9	60711.ENSCSAP00000000190	0.909	P21 protein (Cdc42/Rac)-activated kinase 1
10	60711.ENSCSAP00000004594	0.848	Sequestosome 1
11	60711.ENSCSAP00000012883	0.834	Mitogen-activated protein kinase kinase kinase 2
12	60711.ENSCSAP00000006991	0.826	Belongs to the protein kinase superfamily.
13	60711.ENSCSAP00000009363	0.825	Belongs to the protein kinase superfamily.
14	60711.ENSCSAP00000005373	0.822	Belongs to the protein kinase superfamily.
15	60711.ENSCSAP00000004095	0.800	annotation not available
16	60711.ENSCSAP00000007146	0.800	CD247 molecule
17	60711.ENSCSAP00000001253	0.798	Mitogen-activated protein kinase 11
18	60711.ENSCSAP00000003494	0.780	annotation not available
19	60711.ENSCSAP00000004025	0.780	KRAS proto-oncogene, GTPase
20	60711.ENSCSAP00000006415	0.778	Mitogen-activated protein kinase 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0019899	0.781	enzyme binding
GO:0004709	0.726	MAP kinase kinase kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0050896	0.899	response to stimulus
GO:0051716	0.848	cellular response to stimulus
GO:0032501	0.845	multicellular organismal process
GO:0048856	0.842	anatomical structure development
GO:0048518	0.840	positive regulation of biological process
GO:0007275	0.789	multicellular organism development
GO:0048522	0.770	positive regulation of cellular process
GO:0023052	0.751	signaling
GO:0048583	0.742	regulation of response to stimulus
GO:0007154	0.736	cell communication
GO:0007165	0.695	signal transduction
GO:0008152	0.676	metabolic process
GO:0071704	0.641	organic substance metabolic process
GO:0044237	0.640	cellular metabolic process
GO:0044238	0.639	primary metabolic process
GO:0006807	0.604	nitrogen compound metabolic process
GO:0010646	0.576	regulation of cell communication
GO:0023051	0.575	regulation of signaling
GO:0009966	0.568	regulation of signal transduction
GO:0043170	0.553	macromolecule metabolic process
GO:1902531	0.539	regulation of intracellular signal transduction
GO:1901564	0.536	organonitrogen compound metabolic process
GO:0019538	0.491	protein metabolic process
GO:0036211	0.443	protein modification process
GO:0035556	0.443	intracellular signal transduction
GO:0048584	0.440	positive regulation of response to stimulus
GO:0048731	0.430	system development
GO:0031323	0.425	regulation of cellular metabolic process
GO:0048519	0.411	negative regulation of biological process
GO:0006796	0.374	phosphate-containing compound metabolic process
GO:0009798	0.369	axis specification
GO:0072359	0.348	circulatory system development
GO:0048523	0.347	negative regulation of cellular process
GO:0009967	0.329	positive regulation of signal transduction
GO:0016310	0.316	phosphorylation
GO:0006468	0.306	protein phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.966	membrane-bounded organelle
GO:0043229	0.965	intracellular organelle
GO:0043231	0.962	intracellular membrane-bounded organelle
GO:0005634	0.932	nucleus
GO:0043233	0.406	organelle lumen
GO:0031981	0.401	nuclear lumen
GO:0005654	0.339	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.11.25	0.726	mitogen-activated protein kinase kinase kinase.

[back to server]