StarFunc result for job id Q99767

User Input

>input (749 residues)
MAHRKLESVGSGMLDHRVRPGPVPHSQEPESEDMELPLEGYVPEGLELAALRPESPAPEE
QECHNHSPDGDSSSDYVNNTSEEEDYDEGLPEEEEGITYYIRYCPEDDSYLEGMDCNGEE
YLAHSAHPVDTDECQEAVEEWTDSAGPHPHGHEAEGSQDYPDGQLPIPEDEPSVLEAHDQ
EEDGHYCASKEGYQDYYPEEANGNTGASPYRLRRGDGDLEDQEEDIDQIVAEIKMSLSMT
SITSASEASPEHGPEPGPEDSVEACPPIKASCSPSRHEARPKSLNLLPEAKHPGDPQRGF
KPKTRTPEERLKWPHEQVCNGLEQPRKQQRSDLNGPVDNNNIPETKKVASFPSFVAVPGP
CEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKRMQKAAKIKKKANSE
GDAQTLTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSAS
QDCIETTPGAQEGKKQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQ
KEYSDIINTQEMYNDDLIHFSNSENCKELQLEKHKGEILGVVVVESGWGSILPTVILANM
MNGGPAARSGKLSIGDQIMSINGTSLVGLPLATCQGIIKGLKNQTQVKLNIVSCPPVTTV
LIKRPDLKYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATAHEKIVQAL
SNSVGEIHMKTMPAAMFRLLTGQETPLYI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35431	0.537	0.536	0.000	750	0.924	0.923	O35431.pdb.gz	APBA2_RAT Amyloid-beta A4 precursor protein-binding family A member 2 OS=Rattus norvegicus OX=10116 GN=Apba2 PE=1 SV=1
2	AFDB:Q9W2S5	0.393	0.150	3.400E-54	2139	0.390	0.137	Q9W2S5.pdb.gz	Q9W2S5_DROME X11Lbeta, isoform A OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=1 SV=5
3	PDB:2xkxA	0.106	0.110	4.347E-9	721	0.061	0.064	2xkxA.pdb.gz
4	PDB:6pcvA	0.108	0.107	1.143E-5	754	0.044	0.044	6pcvA.pdb.gz
5	PDB:5n7dA	0.105	0.178	2.350E-5	423	0.036	0.064	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
6	AFDB:E9Q9R9	0.110	0.049	3.284E-5	1921	0.147	0.057	E9Q9R9.pdb.gz	DLG5_MOUSE Disks large homolog 5 OS=Mus musculus OX=10090 GN=Dlg5 PE=1 SV=1
7	PDB:7pc3A	0.103	0.184	3.464E-5	405	0.027	0.049	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
8	PDB:7p73A	0.102	0.179	3.871E-5	420	0.029	0.052	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
9	AFDB:Q9UQF2	0.155	0.163	5.118E-5	711	0.130	0.136	Q9UQF2.pdb.gz	JIP1_HUMAN C-Jun-amino-terminal kinase-interacting protein 1 OS=Homo sapiens OX=9606 GN=MAPK8IP1 PE=1 SV=1
10	AFDB:B1Q240	0.121	0.100	1.832E-4	915	0.113	0.093	B1Q240.pdb.gz	B1Q240_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-1 PE=1 SV=2
11	PDB:3pv2B	0.085	0.158	2.043E-4	388	0.037	0.072	3pv2B.pdb.gz
12	AFDB:Q9W283	0.113	0.066	2.556E-4	1329	0.140	0.079	Q9W283.pdb.gz	Q9W283_DROME Arc, isoform A OS=Drosophila melanogaster OX=7227 GN=a PE=2 SV=2
13	PDB:7pcbA	0.105	0.185	3.365E-4	415	0.028	0.051	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
14	PDB:7pc5A	0.104	0.187	6.547E-4	405	0.027	0.049	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
15	PDB:7p70A	0.109	0.194	8.639E-4	407	0.023	0.042	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
16	PDB:7qqnC	0.096	0.170	9.652E-4	414	0.031	0.056	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
17	AFDB:Q96RT1	0.104	0.060	9.672E-4	1412	0.147	0.078	Q96RT1.pdb.gz	ERBIN_HUMAN Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2
18	AFDB:M0R9T2	0.106	0.066	1.081E-3	1258	0.142	0.084	M0R9T2.pdb.gz	M0R9T2_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=3
19	AFDB:Q13009	0.114	0.060	2.932E-3	1591	0.143	0.067	Q13009.pdb.gz	TIAM1_HUMAN Rho guanine nucleotide exchange factor TIAM1 OS=Homo sapiens OX=9606 GN=TIAM1 PE=1 SV=2
20	AFDB:Q95QI2	0.129	0.113	3.276E-3	868	0.099	0.085	Q95QI2.pdb.gz	Q95QI2_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lim-8 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RUJ5	0.0	712	842	0.454	0.404	APBA1_MOUSE Amyloid-beta A4 precursor protein-binding family A member 1 OS=Mus musculus OX=10090 GN=Apba1 PE=1 SV=2
2	O35430	0.0	709	839	0.453	0.404	APBA1_RAT Amyloid-beta A4 precursor protein-binding family A member 1 OS=Rattus norvegicus OX=10116 GN=Apba1 PE=1 SV=1
3	O35431	0.0	1407	750	0.924	0.923	APBA2_RAT Amyloid-beta A4 precursor protein-binding family A member 2 OS=Rattus norvegicus OX=10116 GN=Apba2 PE=1 SV=1
4	P98084	0.0	1409	750	0.925	0.924	APBA2_MOUSE Amyloid-beta A4 precursor protein-binding family A member 2 OS=Mus musculus OX=10090 GN=Apba2 PE=1 SV=2
5	Q02410	0.0	716	837	0.458	0.410	APBA1_HUMAN Amyloid-beta A4 precursor protein-binding family A member 1 OS=Homo sapiens OX=9606 GN=APBA1 PE=1 SV=3
6	Q99767	0.0	1549	749	1.000	1.000	APBA2_HUMAN Amyloid-beta A4 precursor protein-binding family A member 2 OS=Homo sapiens OX=9606 GN=APBA2 PE=1 SV=3
7	O96018	8.66e-163	484	575	0.324	0.423	APBA3_HUMAN Amyloid-beta A4 precursor protein-binding family A member 3 OS=Homo sapiens OX=9606 GN=APBA3 PE=1 SV=1
8	O70248	1.87e-156	468	569	0.307	0.404	APBA3_RAT Amyloid-beta A4 precursor protein-binding family A member 3 OS=Rattus norvegicus OX=10116 GN=Apba3 PE=1 SV=2
9	Q5BI79	1.54e-151	483	1603	0.327	0.153	Q5BI79_DROME LP19469p (Fragment) OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=2 SV=1
10	O17583	2.35e-150	465	982	0.316	0.241	LIN10_CAEEL Protein lin-10 OS=Caenorhabditis elegans OX=6239 GN=lin-10 PE=1 SV=1
11	O88888	7.47e-150	451	571	0.306	0.401	APBA3_MOUSE Amyloid-beta A4 precursor protein-binding family A member 3 OS=Mus musculus OX=10090 GN=Apba3 PE=1 SV=1
12	X2JE74	1.20e-149	468	1170	0.331	0.212	X2JE74_DROME X11L, isoform F OS=Drosophila melanogaster OX=7227 GN=X11L PE=4 SV=1
13	Q9W2S5	1.94e-149	483	2139	0.326	0.114	Q9W2S5_DROME X11Lbeta, isoform A OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=1 SV=5
14	E1JJN6	3.93e-149	467	1168	0.331	0.212	E1JJN6_DROME X11L, isoform B OS=Drosophila melanogaster OX=7227 GN=X11L PE=4 SV=1
15	M9PGU7	4.02e-149	482	2066	0.326	0.118	M9PGU7_DROME X11Lbeta, isoform D OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=4 SV=2
16	Q9VX41	4.50e-149	467	1167	0.331	0.213	Q9VX41_DROME LD29081p OS=Drosophila melanogaster OX=7227 GN=X11L PE=1 SV=2
17	Q9GQQ6	5.11e-149	467	1168	0.331	0.212	Q9GQQ6_DROME DX11 OS=Drosophila melanogaster OX=7227 GN=X11L PE=1 SV=1
18	X2JB44	8.16e-149	481	2129	0.326	0.115	X2JB44_DROME X11Lbeta, isoform E OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=4 SV=1
19	M9PF12	1.27e-147	463	1162	0.328	0.212	M9PF12_DROME X11L, isoform E OS=Drosophila melanogaster OX=7227 GN=X11L PE=4 SV=2
20	F1QFG9	3.32e-12	70.5	307	0.056	0.137	F1QFG9_DANRE Syndecan-binding protein (syntenin) OS=Danio rerio OX=7955 GN=sb:eu862 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16733 NRho	5.8e+02	12.1	Rhomboid N-terminal domain
2	PF00595 PDZ	3.8e-23	93.0	PDZ domain
3	PF13180 PDZ_2	3.8	19.3	PDZ domain
4	PF17820 PDZ_6	2.7e-11	54.5	PDZ domain
5	PF02163 Peptidase_M50	4.7	18.0	Peptidase family M50
6	PF00640 PID	3.8e-48	174.5	Phosphotyrosine interaction domain (PTB/PID)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000453293

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000284981	0.999	Amyloid-beta A4 protein
2	9606.ENSP00000362399	0.958	Syntaxin-binding protein 1
3	9606.ENSP00000366513	0.953	Calsyntenin-1
4	9606.ENSP00000385142	0.946	Neurexin-1
5	9606.ENSP00000246190	0.941	N-terminal EF-hand calcium-binding protein 3
6	9606.ENSP00000367408	0.897	Peripheral plasma membrane protein CASK
7	9606.ENSP00000477213	0.895	Amyloid-beta A4 precursor protein-binding family B member 1
8	9606.ENSP00000265459	0.894	Neurexin-2
9	9606.ENSP00000222812	0.831	Syntaxin-1A
10	9606.ENSP00000427211	0.795	Amyloid-beta A4 precursor protein-binding family B member 2
11	9606.ENSP00000326366	0.792	Presenilin-1
12	9606.ENSP00000355387	0.725	Secretory carrier-associated membrane protein 5
13	9606.ENSP00000263574	0.721	Amyloid-like protein 2
14	9606.ENSP00000293662	0.704	General receptor for phosphoinositides 1-associated scaffold protein
15	9606.ENSP00000451648	0.702	Neurexin-3
16	9606.ENSP00000231790	0.700	DNA mismatch repair protein Mlh1
17	9606.ENSP00000428182	0.695	MAGUK p55 subfamily member 2
18	9606.ENSP00000386787	0.689	Transmembrane protein 131-like
19	9606.ENSP00000350050	0.683	Transmembrane protein 229B
20	9606.ENSP00000222644	0.658	MAGUK p55 subfamily member 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001540	0.798	amyloid-beta binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0048856	0.984	anatomical structure development
GO:0065007	0.983	biological regulation
GO:0032501	0.978	multicellular organismal process
GO:0007275	0.962	multicellular organism development
GO:0050789	0.915	regulation of biological process
GO:0050794	0.902	regulation of cellular process
GO:0051179	0.877	localization
GO:0023052	0.873	signaling
GO:0007154	0.873	cell communication
GO:0099536	0.848	synaptic signaling
GO:0099537	0.757	trans-synaptic signaling
GO:0051234	0.713	establishment of localization
GO:0098916	0.676	anterograde trans-synaptic signaling
GO:0007268	0.646	chemical synaptic transmission
GO:0006810	0.638	transport
GO:0019222	0.462	regulation of metabolic process
GO:0060255	0.440	regulation of macromolecule metabolic process
GO:0051641	0.326	cellular localization
GO:0050896	0.325	response to stimulus
GO:0048731	0.309	system development
GO:0065008	0.305	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	0.991	plasma membrane
GO:0005829	0.986	cytosol
GO:0043226	0.960	organelle
GO:0043231	0.940	intracellular membrane-bounded organelle
GO:0030054	0.628	cell junction
GO:0045202	0.489	synapse
GO:0012505	0.463	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]