StarFunc result for job id Q99788

User Input

>input (373 residues)
MRMEDEDYNTSISYGDEYPDYLDSIVVLEDLSPLEARVTRIFLVVVYSIVCFLGILGNGL
VIIIATFKMKKTVNMVWFLNLAVADFLFNVFLPIHITYAAMDYHWVFGTAMCKISNFLLI
HNMFTSVFLLTIISSDRCISVLLPVWSQNHRSVRLAYMACMVIWVLAFFLSSPSLVFRDT
ANLHGKISCFNNFSLSTPGSSSWPTHSQMDPVGYSRHMVVTVTRFLCGFLVPVLIITACY
LTIVCKLQRNRLAKTKKPFKIIVTIIITFFLCWCPYHTLNLLELHHTAMPGSVFSLGLPL
ATALAIANSCMNPILYVFMGQDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMN
ERTSMNERETGML

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99788	1.000	1.000	7.355E-48	373	1.000	1.000	Q99788.pdb.gz	CML1_HUMAN Chemerin-like receptor 1 OS=Homo sapiens OX=9606 GN=CMKLR1 PE=1 SV=2
2	AFDB:O35786	0.858	0.862	5.306E-36	371	0.756	0.760	O35786.pdb.gz	CML1_RAT Chemerin-like receptor 1 OS=Rattus norvegicus OX=10116 GN=Cmklr1 PE=1 SV=2
3	AFDB:E7FF45	0.804	0.806	9.496E-24	372	0.405	0.406	E7FF45.pdb.gz	E7FF45_DANRE Chemokine-like receptor 1 OS=Danio rerio OX=7955 GN=fpr1 PE=3 SV=1
4	AFDB:Q8K087	0.761	0.802	1.693E-20	353	0.330	0.348	Q8K087.pdb.gz	CML2_MOUSE Chemerin-like receptor 2 OS=Mus musculus OX=10090 GN=Cmklr2 PE=2 SV=1
5	AFDB:O88537	0.735	0.794	2.725E-20	343	0.319	0.347	O88537.pdb.gz	FPRS3_MOUSE Formyl peptide receptor-related sequence 3 OS=Mus musculus OX=10090 GN=Fpr-rs3 PE=2 SV=2
6	AFDB:C1BI79	0.738	0.768	3.103E-20	358	0.314	0.327	C1BI79.pdb.gz	C1BI79_ONCMY Chemokine receptor-like 1 OS=Oncorhynchus mykiss OX=8022 GN=CML1 PE=2 SV=1
7	AFDB:D4A7Q2	0.753	0.788	3.852E-20	355	0.332	0.349	D4A7Q2.pdb.gz	D4A7Q2_RAT Formyl peptide receptor 1 OS=Rattus norvegicus OX=10116 GN=Fpr1 PE=3 SV=1
8	AFDB:P46091	0.772	0.809	4.994E-20	355	0.324	0.341	P46091.pdb.gz	CML2_HUMAN Chemerin-like receptor 2 OS=Homo sapiens OX=9606 GN=CMKLR2 PE=1 SV=2
9	AFDB:P21462	0.735	0.781	8.039E-20	350	0.338	0.360	P21462.pdb.gz	FPR1_HUMAN fMet-Leu-Phe receptor OS=Homo sapiens OX=9606 GN=FPR1 PE=1 SV=3
10	AFDB:P33766	0.746	0.764	8.394E-20	364	0.338	0.346	P33766.pdb.gz	FPR1_MOUSE fMet-Leu-Phe receptor OS=Mus musculus OX=10090 GN=Fpr1 PE=2 SV=1
11	PDB:7wvuR	0.678	0.836	1.653E-16	298	0.298	0.372	7wvuR.pdb.gz	Structural basis of FPR2 in recognition of A beta 42 and neuroprotection by humanin.
12	PDB:6lw5A	0.681	0.600	2.548E-16	427	0.292	0.255	6lw5A.pdb.gz	Structural basis of ligand binding modes at the human formyl peptide receptor 2.
13	PDB:8ef5M	0.657	0.834	2.104E-14	288	0.239	0.309	8ef5M.pdb.gz	Molecular recognition of morphine and fentanyl by the human mu-opioid receptor.
14	PDB:7wicR	0.662	0.845	2.727E-14	288	0.252	0.326	7wicR.pdb.gz	Structures of the endogenous peptide- and selective non-peptide agonist-bound SSTR2 signaling complexes.
15	PDB:7vl9R	0.658	0.800	1.831E-13	302	0.225	0.278	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.
16	PDB:7f1tA	0.664	0.589	2.947E-13	423	0.220	0.194	7f1tA.pdb.gz	Structural basis for chemokine recognition and receptor activation of chemokine receptor CCR5.
17	PDB:5zbqA	0.664	0.541	3.989E-13	463	0.220	0.177	5zbqA.pdb.gz	Structural basis of ligand binding modes at the neuropeptide Y Y1receptor
18	PDB:7vktA	0.649	0.834	7.311E-13	287	0.223	0.289	7vktA.pdb.gz	Structural basis of leukotriene B4 receptor 1 activation.
19	PDB:7f1qR	0.670	0.681	1.399E-12	367	0.217	0.221	7f1qR.pdb.gz
20	PDB:7wq3R	0.634	0.804	1.978E-12	289	0.204	0.263	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35786	0.0	611	372	0.815	0.817	CML1_RAT Chemerin-like receptor 1 OS=Rattus norvegicus OX=10116 GN=Cmklr1 PE=1 SV=2
2	P97468	0.0	607	371	0.799	0.803	CML1_MOUSE Chemerin-like receptor 1 OS=Mus musculus OX=10090 GN=Cmklr1 PE=1 SV=1
3	Q99788	0.0	769	373	1.000	1.000	CML1_HUMAN Chemerin-like receptor 1 OS=Homo sapiens OX=9606 GN=CMKLR1 PE=1 SV=2
4	E7FF45	9.08e-100	302	372	0.429	0.430	E7FF45_DANRE Chemokine-like receptor 1 OS=Danio rerio OX=7955 GN=fpr1 PE=3 SV=1
5	Q8K087	2.72e-71	228	353	0.319	0.337	CML2_MOUSE Chemerin-like receptor 2 OS=Mus musculus OX=10090 GN=Cmklr2 PE=2 SV=1
6	D4A7Q2	1.45e-68	221	355	0.332	0.349	D4A7Q2_RAT Formyl peptide receptor 1 OS=Rattus norvegicus OX=10116 GN=Fpr1 PE=3 SV=1
7	P46091	3.28e-68	220	355	0.314	0.330	CML2_HUMAN Chemerin-like receptor 2 OS=Homo sapiens OX=9606 GN=CMKLR2 PE=1 SV=2
8	P33766	1.45e-67	219	364	0.351	0.360	FPR1_MOUSE fMet-Leu-Phe receptor OS=Mus musculus OX=10090 GN=Fpr1 PE=2 SV=1
9	O88536	3.65e-67	218	351	0.338	0.359	FPR2_MOUSE Formyl peptide receptor 2 OS=Mus musculus OX=10090 GN=Fpr2 PE=1 SV=1
10	C1BI79	1.16e-65	214	358	0.335	0.349	C1BI79_ONCMY Chemokine receptor-like 1 OS=Oncorhynchus mykiss OX=8022 GN=CML1 PE=2 SV=1
11	A0A8I6AM80	1.96e-64	211	351	0.338	0.359	A0A8I6AM80_RAT Formyl peptide receptor 2 OS=Rattus norvegicus OX=10116 GN=Fpr2 PE=3 SV=1
12	Q3SXG2	3.45e-62	204	339	0.314	0.345	FPRS6_MOUSE Formyl peptide receptor-related sequence 6 OS=Mus musculus OX=10090 GN=Fpr-rs6 PE=2 SV=1
13	O08790	1.51e-61	203	351	0.340	0.362	FPRS1_MOUSE Formyl peptide receptor-related sequence 1 OS=Mus musculus OX=10090 GN=Fpr-s1 PE=1 SV=2
14	Q71MR7	1.73e-61	202	338	0.316	0.349	FPRS7_MOUSE Formyl peptide receptor-related sequence 7 OS=Mus musculus OX=10090 GN=Fpr-rs7 PE=2 SV=2
15	P25089	3.59e-61	202	353	0.330	0.348	FPR3_HUMAN N-formyl peptide receptor 3 OS=Homo sapiens OX=9606 GN=FPR3 PE=2 SV=2
16	P25090	3.04e-60	199	351	0.327	0.348	FPR2_HUMAN N-formyl peptide receptor 2 OS=Homo sapiens OX=9606 GN=FPR2 PE=1 SV=2
17	P21462	3.30e-60	199	350	0.316	0.337	FPR1_HUMAN fMet-Leu-Phe receptor OS=Homo sapiens OX=9606 GN=FPR1 PE=1 SV=3
18	O88537	4.13e-60	199	343	0.319	0.347	FPRS3_MOUSE Formyl peptide receptor-related sequence 3 OS=Mus musculus OX=10090 GN=Fpr-rs3 PE=2 SV=2
19	A4FUQ5	4.27e-59	196	323	0.306	0.353	FPRS4_MOUSE Formyl peptide receptor-related sequence 4 OS=Mus musculus OX=10090 GN=Fpr-rs4 PE=2 SV=2
20	Q9Y5Y4	1.41e-57	194	395	0.306	0.289	PD2R2_HUMAN Prostaglandin D2 receptor 2 OS=Homo sapiens OX=9606 GN=PTGDR2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	8.1e-38	141.8	7 transmembrane receptor (rhodopsin family)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311733

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000418009	0.992	Retinoic acid receptor responder protein 2
2	9606.ENSP00000482604	0.662	Hematopoietic SH2 domain-containing protein
3	9606.ENSP00000386444	0.654	S-arrestin
4	9606.ENSP00000313582	0.594	Zinc finger protein 436
5	9606.ENSP00000422533	0.567	Adhesion G protein-coupled receptor L3
6	9606.ENSP00000363512	0.562	Arachidonate 5-lipoxygenase
7	9606.ENSP00000344277	0.556	Docking protein 4
8	9606.ENSP00000327608	0.554	ADAMTS-like protein 5
9	9606.ENSP00000355210	0.530	Transmembrane protein 184B
10	9606.ENSP00000261438	0.513	Krueppel-like factor 3
11	9606.ENSP00000248114	0.506	FAD-linked sulfhydryl oxidase ALR

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008528	1.000	G protein-coupled peptide receptor activity
GO:0005488	0.997	binding
GO:0001637	0.993	G protein-coupled chemoattractant receptor activity
GO:0005515	0.987	protein binding
GO:0033218	0.354	amide binding
GO:0140375	0.344	immune receptor activity
GO:0042277	0.341	peptide binding
GO:0005102	0.331	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050794	0.990	regulation of cellular process
GO:0050896	0.989	response to stimulus
GO:0009987	0.988	cellular process
GO:0051716	0.968	cellular response to stimulus
GO:0048522	0.953	positive regulation of cellular process
GO:0007154	0.902	cell communication
GO:0023052	0.873	signaling
GO:0007165	0.856	signal transduction
GO:0019222	0.808	regulation of metabolic process
GO:0048583	0.774	regulation of response to stimulus
GO:0002376	0.737	immune system process
GO:0002682	0.731	regulation of immune system process
GO:0042221	0.700	response to chemical
GO:0048519	0.699	negative regulation of biological process
GO:0007186	0.682	G protein-coupled receptor signaling pathway
GO:0032501	0.630	multicellular organismal process
GO:0048584	0.619	positive regulation of response to stimulus
GO:0060255	0.547	regulation of macromolecule metabolic process
GO:0032502	0.540	developmental process
GO:0002684	0.508	positive regulation of immune system process
GO:0051239	0.490	regulation of multicellular organismal process
GO:0009893	0.489	positive regulation of metabolic process
GO:0009605	0.482	response to external stimulus
GO:0032101	0.466	regulation of response to external stimulus
GO:0080090	0.464	regulation of primary metabolic process
GO:0051171	0.459	regulation of nitrogen compound metabolic process
GO:0010468	0.459	regulation of gene expression
GO:0031323	0.456	regulation of cellular metabolic process
GO:0009966	0.448	regulation of signal transduction
GO:0006955	0.440	immune response
GO:0006950	0.423	response to stress
GO:0048856	0.403	anatomical structure development
GO:0050793	0.399	regulation of developmental process
GO:0010604	0.393	positive regulation of macromolecule metabolic process
GO:0030334	0.388	regulation of cell migration
GO:0048523	0.380	negative regulation of cellular process
GO:0010033	0.370	response to organic substance
GO:0070887	0.360	cellular response to chemical stimulus
GO:0030335	0.331	positive regulation of cell migration
GO:0006935	0.324	chemotaxis
GO:0051240	0.320	positive regulation of multicellular organismal process
GO:0032103	0.306	positive regulation of response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005622	0.798	intracellular anatomical structure
GO:0043226	0.682	organelle
GO:0043227	0.604	membrane-bounded organelle
GO:0005737	0.561	cytoplasm
GO:0043231	0.545	intracellular membrane-bounded organelle
GO:0070013	0.451	intracellular organelle lumen
GO:0031981	0.313	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]