StarFunc result for job id Q99798

User Input

>input (780 residues)
MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLN
RPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAV
PSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILEN
YAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSG
WSSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYN
HRMKKYLSKTGREDIANLADEFKDHLVPDPGCHYDQLIEINLSELKPHINGPFTPDLAHP
VAEVGKVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGS
EQIRATIERDGYAQILRDLGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRN
DANPETHAFVTSPEIVTALAIAGTLKFNPETDYLTGTDGKKFRLEAPDADELPKGEFDPG
QDTYQHPPKDSSGQHVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAA
GPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVI
GDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIHP
VDKLTIQGLKDFTPGKPLKCIIKHPNGTQETILLNHTFNETQIEWFRAGSALNRMKELQQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1acoA	0.962	0.996	0.000	753	0.928	0.961	1acoA.pdb.gz	Crystal structures of aconitase with trans-aconitate and nitrocitrate bound.
2	AFDB:G8BGE3	0.962	0.949	0.000	790	0.638	0.630	G8BGE3.pdb.gz	G8BGE3_CANPC Aconitate hydratase, mitochondrial OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=ACO1 PE=3 SV=1
3	AFDB:O13966	0.960	0.949	0.000	789	0.654	0.646	O13966.pdb.gz	ACON_SCHPO Aconitate hydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC24C9.06c PE=3 SV=2
4	AFDB:P19414	0.960	0.963	0.000	778	0.651	0.653	P19414.pdb.gz	ACON_YEAST Aconitate hydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACO1 PE=1 SV=2
5	AFDB:P34455	0.967	0.971	0.000	777	0.728	0.731	P34455.pdb.gz	ACON_CAEEL Probable aconitate hydratase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=aco-2 PE=3 SV=2
6	AFDB:P39533	0.942	0.931	0.000	789	0.526	0.520	P39533.pdb.gz	ACON2_YEAST Homocitrate dehydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACO2 PE=1 SV=1
7	AFDB:P82611	0.959	0.962	0.000	777	0.637	0.640	P82611.pdb.gz	ACON_CANAL Aconitate hydratase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ACO1 PE=1 SV=2
8	AFDB:Q4WLN1	0.957	0.949	0.000	787	0.665	0.659	Q4WLN1.pdb.gz	ACON_ASPFU Aconitate hydratase, mitochondrial OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=acoA PE=1 SV=1
9	AFDB:Q54XS2	0.959	0.970	0.000	771	0.660	0.668	Q54XS2.pdb.gz	ACON_DICDI Probable aconitate hydratase, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=aco2 PE=3 SV=1
10	AFDB:Q8AYI3	0.979	0.973	0.000	785	0.915	0.910	Q8AYI3.pdb.gz	Q8AYI3_CHICK Aconitate hydratase, mitochondrial OS=Gallus gallus OX=9031 GN=ACO2 PE=2 SV=1
11	AFDB:Q8T4D6	0.961	0.957	0.000	783	0.690	0.687	Q8T4D6.pdb.gz	Q8T4D6_DROME Aconitate hydratase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mAcon2 PE=2 SV=1
12	PDB:2b3xA	0.804	0.709	2.172E-54	888	0.264	0.232	2b3xA.pdb.gz	Crystal structure of human iron regulatory protein 1 as cytosolic aconitase
13	PDB:6vcdA	0.469	0.550	8.417E-30	643	0.187	0.227	6vcdA.pdb.gz	FBXL5 Regulates IRP2 Stability in Iron Homeostasis via an Oxygen-Responsive [2Fe2S] Cluster.
14	PDB:1l5jA	0.487	0.443	7.841E-27	862	0.119	0.108	1l5jA.pdb.gz	E. coli aconitase B structure reveals a HEAT-like domain with implications for protein-protein recognition.
15	PDB:2pkpA	0.180	0.756	1.231E-6	167	0.053	0.246	2pkpA.pdb.gz	Substrate specificity determinants of the methanogen homoaconitase enzyme: structure and function of the small subunit
16	PDB:3vbaA	0.137	0.561	1.828E-6	169	0.045	0.207	3vbaA.pdb.gz
17	PDB:3h5hB	0.148	0.587	1.339E-4	169	0.044	0.201	3h5hB.pdb.gz
18	PDB:5tmbA	0.117	0.161	1.933E-2	451	0.068	0.118	5tmbA.pdb.gz	Crystal Structure of Os79 (Os04g0206600) from Oryza sativa: A UDP-glucosyltransferase Involved in the Detoxification of Deoxynivalenol.
19	PDB:2vg8A	0.120	0.169	2.713E-2	465	0.071	0.118	2vg8A.pdb.gz	Characterization and Engineering of the Bifunctional N- and O-Glucosyltransferase Involved in Xenobiotic Metabolism in Plants.
20	PDB:2jaxA	0.097	0.214	3.402E-2	261	0.045	0.134	2jaxA.pdb.gz	Crystal Structure of Universal Stress Protein Rv2623 from Mycobacterium Tuberculosis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C8VG90	0.0	1082	783	0.664	0.662	ACON_EMENI Aconitate hydratase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=acoA PE=1 SV=1
2	G8BGE3	0.0	1040	790	0.638	0.630	G8BGE3_CANPC Aconitate hydratase, mitochondrial OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=ACO1 PE=3 SV=1
3	O13966	0.0	1073	789	0.653	0.645	ACON_SCHPO Aconitate hydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC24C9.06c PE=3 SV=2
4	P19414	0.0	1070	778	0.656	0.658	ACON_YEAST Aconitate hydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACO1 PE=1 SV=2
5	P20004	0.0	1575	780	0.967	0.967	ACON_BOVIN Aconitate hydratase, mitochondrial OS=Bos taurus OX=9913 GN=ACO2 PE=1 SV=4
6	P34455	0.0	1160	777	0.727	0.730	ACON_CAEEL Probable aconitate hydratase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=aco-2 PE=3 SV=2
7	P39533	0.0	818	789	0.528	0.522	ACON2_YEAST Homocitrate dehydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACO2 PE=1 SV=1
8	P82611	0.0	1044	777	0.644	0.646	ACON_CANAL Aconitate hydratase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ACO1 PE=1 SV=2
9	Q4WLN1	0.0	1092	787	0.669	0.663	ACON_ASPFU Aconitate hydratase, mitochondrial OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=acoA PE=1 SV=1
10	Q54XS2	0.0	1091	771	0.659	0.667	ACON_DICDI Probable aconitate hydratase, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=aco2 PE=3 SV=1
11	Q6FVR0	0.0	1069	777	0.654	0.656	Q6FVR0_CANGA Aconitate hydratase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ACO1 PE=3 SV=1
12	Q8AYI3	0.0	1471	785	0.917	0.911	Q8AYI3_CHICK Aconitate hydratase, mitochondrial OS=Gallus gallus OX=9031 GN=ACO2 PE=2 SV=1
13	Q8T4D6	0.0	1095	783	0.687	0.685	Q8T4D6_DROME Aconitate hydratase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mAcon2 PE=2 SV=1
14	Q99798	0.0	1616	780	1.000	1.000	ACON_HUMAN Aconitate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ACO2 PE=1 SV=2
15	Q99KI0	0.0	1575	780	0.968	0.968	ACON_MOUSE Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1
16	Q9ER34	0.0	1568	780	0.964	0.964	ACON_RAT Aconitate hydratase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Aco2 PE=1 SV=2
17	Q9P7D4	0.0	815	918	0.517	0.439	ACON2_SCHPO Aconitase-ribosomal protein bL21m fusion protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=aco2 PE=3 SV=3
18	Q9VIE8	0.0	1136	787	0.713	0.706	Q9VIE8_DROME Aconitate hydratase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mAcon1 PE=1 SV=2
19	Q42560	2.05e-60	222	898	0.304	0.264	ACO1_ARATH Aconitate hydratase 1 OS=Arabidopsis thaliana OX=3702 GN=ACO1 PE=1 SV=2
20	Q94A28	1.01e-58	218	995	0.282	0.221	ACO2M_ARATH Aconitate hydratase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ACO2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00330 Aconitase	3.9e-148	505.9	Aconitase family (aconitate hydratase)
2	PF00694 Aconitase_C	2.1e-45	165.7	Aconitase C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216254

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000299518	0.999	Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial
2	9606.ENSP00000217901	0.998	Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial
3	9606.ENSP00000342056	0.998	Citrate synthase, mitochondrial
4	9606.ENSP00000370223	0.996	Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial
5	9606.ENSP00000355518	0.994	Fumarate hydratase, mitochondrial
6	9606.ENSP00000262030	0.990	ATP synthase subunit beta, mitochondrial
7	9606.ENSP00000381736	0.986	ATP synthase subunit alpha, mitochondrial
8	9606.ENSP00000317159	0.985	Cytochrome c1, heme protein, mitochondrial
9	9606.ENSP00000327070	0.984	Malate dehydrogenase, mitochondrial
10	9606.ENSP00000331897	0.982	Isocitrate dehydrogenase [NADP], mitochondrial
11	9606.ENSP00000253792	0.979	ATP-citrate synthase
12	9606.ENSP00000390265	0.978	Isocitrate dehydrogenase 1, cytosolic
13	9606.ENSP00000307241	0.968	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
14	9606.ENSP00000297185	0.963	Stress-70 protein, mitochondrial
15	9606.ENSP00000373620	0.963	60 kDa heat shock protein, mitochondrial
16	9606.ENSP00000281456	0.962	ADP/ATP translocase 1
17	9606.ENSP00000264932	0.961	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
18	9606.ENSP00000377446	0.959	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
19	9606.ENSP00000364649	0.956	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
20	9606.ENSP00000410339	0.955	Mitochondrial import receptor subunit TOM40 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003994	1.000	aconitate hydratase activity
GO:0005488	0.996	binding
GO:0097159	0.819	organic cyclic compound binding
GO:1901363	0.818	heterocyclic compound binding
GO:0051536	0.762	iron-sulfur cluster binding
GO:0003676	0.741	nucleic acid binding
GO:0003723	0.574	RNA binding
GO:0005515	0.433	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.996	cellular metabolic process
GO:0044238	0.995	primary metabolic process
GO:0071704	0.991	organic substance metabolic process
GO:0006091	0.966	generation of precursor metabolites and energy
GO:0045333	0.948	cellular respiration
GO:0009060	0.922	aerobic respiration
GO:0006099	0.864	tricarboxylic acid cycle
GO:0006082	0.749	organic acid metabolic process
GO:0006807	0.664	nitrogen compound metabolic process
GO:0043436	0.344	oxoacid metabolic process
GO:0019752	0.306	carboxylic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.997	mitochondrion
GO:0070013	0.989	intracellular organelle lumen
GO:0005759	0.911	mitochondrial matrix
GO:0016020	0.442	membrane
GO:0031981	0.334	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10336	1.000	citrate = D-threo-isocitrate
EC:4.2.1.3	1.000	aconitate hydratase.

[back to server]