StarFunc result for job id Q99801

User Input

>input (234 residues)
MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEP
EPEGGRSRAGAQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTP
KQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTK
RKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99801	0.999	0.999	6.375E-35	234	1.000	1.000	Q99801.pdb.gz	NKX31_HUMAN Homeobox protein Nkx-3.1 OS=Homo sapiens OX=9606 GN=NKX3-1 PE=1 SV=2
2	AFDB:P97436	0.656	0.649	9.955E-24	237	0.675	0.667	P97436.pdb.gz	NKX31_MOUSE Homeobox protein Nkx-3.1 OS=Mus musculus OX=10090 GN=Nkx3-1 PE=1 SV=1
3	AFDB:Q9W7E8	0.478	0.520	3.784E-15	213	0.415	0.455	Q9W7E8.pdb.gz	KOZA_XENLA Homeobox protein koza OS=Xenopus laevis OX=8355 GN=koza PE=2 SV=1
4	AFDB:P22809	0.333	0.207	3.500E-9	382	0.380	0.233	P22809.pdb.gz	BAGP_DROME Homeobox protein bagpipe OS=Drosophila melanogaster OX=7227 GN=bap PE=2 SV=3
5	AFDB:P97503	0.335	0.244	5.533E-9	333	0.355	0.249	P97503.pdb.gz	NKX32_MOUSE Homeobox protein Nkx-3.2 OS=Mus musculus OX=10090 GN=Nkx3-2 PE=1 SV=2
6	AFDB:Q6R3Q6	0.311	0.319	1.917E-8	227	0.244	0.251	Q6R3Q6.pdb.gz	BSH_DANRE Brain-specific homeobox protein homolog OS=Danio rerio OX=7955 GN=bsx PE=2 SV=1
7	AFDB:Q6AXL1	0.326	0.288	2.839E-8	269	0.312	0.271	Q6AXL1.pdb.gz
8	AFDB:Q8BRS9	0.281	0.266	9.217E-8	248	0.265	0.250	Q8BRS9.pdb.gz	Q8BRS9_MOUSE NK2 homeobox 2 OS=Mus musculus OX=10090 GN=Nkx2-2 PE=1 SV=1
9	AFDB:O35767	0.324	0.242	9.840E-8	318	0.248	0.182	O35767.pdb.gz	NKX25_RAT Homeobox protein Nkx-2.5 OS=Rattus norvegicus OX=10116 GN=Nkx2-5 PE=2 SV=1
10	AFDB:Q09604	0.280	0.290	9.840E-8	225	0.269	0.280	Q09604.pdb.gz	VAB15_CAEEL Homeobox protein vab-15 OS=Caenorhabditis elegans OX=6239 GN=vab-15 PE=2 SV=1
11	PDB:4egcA	0.204	0.089	1.047E-2	539	0.073	0.032	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.195	0.570	5.035E-2	73	0.073	0.233	2hi3A.pdb.gz
13	PDB:5nr5A	0.162	0.309	8.954E-1	113	0.085	0.177	5nr5A.pdb.gz
14	PDB:5aj0BZ	0.174	0.415	1.326	86	0.034	0.093	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
15	PDB:7fbyA	0.169	0.228	1.839	153	0.056	0.085	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
16	PDB:2cg4A	0.145	0.220	3.313	149	0.026	0.040	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
17	PDB:4l5jA	0.122	0.095	3.313	308	0.043	0.032	4l5jA.pdb.gz	Crystal Structures of the LsrR Proteins Complexed with Phospho-AI-2 and Two Signal-Interrupting Analogues Reveal Distinct Mechanisms for Ligand Recognition.
18	PDB:5mrcZZ	0.114	0.262	3.537	87	0.068	0.184	5mrcZZ.pdb.gz	The structure of the yeast mitochondrial ribosome.
19	PDB:7dcoL	0.154	0.087	3.537	435	0.051	0.028	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
20	PDB:6wucH	0.153	0.195	3.776	179	0.068	0.089	6wucH.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99801	1.10e-171	473	234	1.000	1.000	NKX31_HUMAN Homeobox protein Nkx-3.1 OS=Homo sapiens OX=9606 GN=NKX3-1 PE=1 SV=2
2	P97436	2.19e-84	252	237	0.675	0.667	NKX31_MOUSE Homeobox protein Nkx-3.1 OS=Mus musculus OX=10090 GN=Nkx3-1 PE=1 SV=1
3	Q9W7E8	1.37e-49	163	213	0.436	0.479	KOZA_XENLA Homeobox protein koza OS=Xenopus laevis OX=8355 GN=koza PE=2 SV=1
4	Q803Z6	1.35e-37	133	245	0.368	0.351	Q803Z6_DANRE Bagpipe homeobox transcription factor Bapx1 OS=Danio rerio OX=7955 GN=nkx3.2 PE=2 SV=1
5	P97503	5.21e-31	118	333	0.282	0.198	NKX32_MOUSE Homeobox protein Nkx-3.2 OS=Mus musculus OX=10090 GN=Nkx3-2 PE=1 SV=2
6	P78367	9.16e-31	117	333	0.282	0.198	NKX32_HUMAN Homeobox protein Nkx-3.2 OS=Homo sapiens OX=9606 GN=NKX3-2 PE=1 SV=2
7	P22809	1.02e-25	105	382	0.201	0.123	BAGP_DROME Homeobox protein bagpipe OS=Drosophila melanogaster OX=7227 GN=bap PE=2 SV=3
8	O13005	1.22e-22	93.2	193	0.197	0.238	O13005_CHICK Nkx2-8 protein OS=Gallus gallus OX=9031 GN=Nkx2-8 PE=2 SV=1
9	Q98873	1.77e-21	92.0	269	0.209	0.182	Q98873_DANRE Homeodomain protein Nkx2.7 OS=Danio rerio OX=7955 GN=nk2.7 PE=2 SV=1
10	Q98872	3.80e-21	91.7	314	0.192	0.143	Q98872_DANRE Homeobox protein Nkx-2.5 OS=Danio rerio OX=7955 GN=nk2.5 PE=2 SV=1
11	P43688	2.43e-20	89.4	289	0.184	0.149	NKX26_MOUSE Homeobox protein Nkx-2.6 OS=Mus musculus OX=10090 GN=Nkx2-6 PE=2 SV=2
12	Q90788	5.56e-20	88.2	294	0.222	0.177	NKX25_CHICK Homeobox protein Nkx-2.5 OS=Gallus gallus OX=9031 GN=NKX-2.5 PE=2 SV=1
13	A6NCS4	6.71e-20	88.2	301	0.197	0.153	NKX26_HUMAN Homeobox protein Nkx-2.6 OS=Homo sapiens OX=9606 GN=NKX2-6 PE=1 SV=1
14	P97334	6.72e-20	89.0	362	0.188	0.122	NKX23_MOUSE Homeobox protein Nkx-2.3 OS=Mus musculus OX=10090 GN=Nkx2-3 PE=2 SV=2
15	Q8TAU0	7.27e-20	89.0	364	0.188	0.121	NKX23_HUMAN Homeobox protein Nkx-2.3 OS=Homo sapiens OX=9606 GN=NKX2-3 PE=2 SV=2
16	Q0P3T9	1.95e-19	83.6	152	0.197	0.303	Q0P3T9_DANRE H6 family homeobox 4 OS=Danio rerio OX=7955 GN=hmx4 PE=2 SV=1
17	P43699	2.73e-19	87.4	371	0.171	0.108	NKX21_HUMAN Homeobox protein Nkx-2.1 OS=Homo sapiens OX=9606 GN=NKX2-1 PE=1 SV=1
18	P23441	3.04e-19	87.4	372	0.171	0.108	NKX21_RAT Homeobox protein Nkx-2.1 OS=Rattus norvegicus OX=10116 GN=Nkx2-1 PE=1 SV=1
19	P50220	3.04e-19	87.4	372	0.171	0.108	NKX21_MOUSE Homeobox protein Nkx-2.1 OS=Mus musculus OX=10090 GN=Nkx2-1 PE=2 SV=1
20	A8KB41	8.25e-19	85.9	345	0.167	0.113	A8KB41_DANRE Homeobox protein Nkx-2.4 isoform 1 OS=Danio rerio OX=7955 GN=fi48a12 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	74	14.7	Homeobox KN domain
2	PF00046 Homeodomain	3.2e-17	73.4	Homeodomain
3	PF05887 Trypan_PARP	1.6	20.1	Procyclic acidic repetitive protein (PARP)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370253

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363149	0.960	SAM pointed domain-containing Ets transcription factor
2	9606.ENSP00000363822	0.917	Androgen receptor
3	9606.ENSP00000451828	0.889	RAC-alpha serine/threonine-protein kinase
4	9606.ENSP00000381588	0.820	Transmembrane protease serine 2
5	9606.ENSP00000375892	0.809	RAC-beta serine/threonine-protein kinase
6	9606.ENSP00000263826	0.807	RAC-gamma serine/threonine-protein kinase
7	9606.ENSP00000265354	0.806	Serum response factor
8	9606.ENSP00000362649	0.793	Histone deacetylase 1
9	9606.ENSP00000314151	0.747	Prostate-specific antigen
10	9606.ENSP00000361021	0.688	Phosphatase and tensin homolog
11	9606.ENSP00000250448	0.682	Hepatocyte nuclear factor 3-alpha
12	9606.ENSP00000313581	0.681	Kallikrein-2
13	9606.ENSP00000356113	0.661	Solute carrier family 45 member 3
14	9606.ENSP00000444810	0.661	Peptidyl-prolyl cis-trans isomerase FKBP5
15	9606.ENSP00000479618	0.661	Myc proto-oncogene protein
16	9606.ENSP00000411565	0.648	Dehydrogenase/reductase SDR family member 12
17	9606.ENSP00000354522	0.640	DNA topoisomerase 1
18	9606.ENSP00000264690	0.630	Plasma kallikrein
19	9606.ENSP00000364166	0.621	Transmembrane protein 225
20	9606.ENSP00000463092	0.615	Beta-microseminoprotein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0003700	0.997	DNA-binding transcription factor activity
GO:1990837	0.997	sequence-specific double-stranded DNA binding
GO:0000981	0.985	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.985	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.925	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.916	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0008134	0.821	transcription factor binding
GO:0140297	0.802	DNA-binding transcription factor binding
GO:0061629	0.304	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.981	cellular process
GO:0019222	0.980	regulation of metabolic process
GO:0048518	0.945	positive regulation of biological process
GO:0080090	0.908	regulation of primary metabolic process
GO:0010468	0.907	regulation of gene expression
GO:0031323	0.905	regulation of cellular metabolic process
GO:0051171	0.878	regulation of nitrogen compound metabolic process
GO:0009889	0.877	regulation of biosynthetic process
GO:0006355	0.874	regulation of DNA-templated transcription
GO:0006357	0.862	regulation of transcription by RNA polymerase II
GO:0048519	0.808	negative regulation of biological process
GO:0048522	0.769	positive regulation of cellular process
GO:0009893	0.722	positive regulation of metabolic process
GO:0032502	0.713	developmental process
GO:0010604	0.712	positive regulation of macromolecule metabolic process
GO:0048856	0.702	anatomical structure development
GO:0032501	0.684	multicellular organismal process
GO:0051173	0.671	positive regulation of nitrogen compound metabolic process
GO:0048523	0.668	negative regulation of cellular process
GO:0050896	0.553	response to stimulus
GO:0007275	0.508	multicellular organism development
GO:0031325	0.501	positive regulation of cellular metabolic process
GO:0031328	0.494	positive regulation of cellular biosynthetic process
GO:0045935	0.493	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.491	positive regulation of macromolecule biosynthetic process
GO:0045893	0.483	positive regulation of DNA-templated transcription
GO:0009892	0.444	negative regulation of metabolic process
GO:0048731	0.441	system development
GO:0051716	0.430	cellular response to stimulus
GO:0045944	0.392	positive regulation of transcription by RNA polymerase II
GO:0042127	0.375	regulation of cell population proliferation
GO:0051172	0.372	negative regulation of nitrogen compound metabolic process
GO:0048513	0.346	animal organ development
GO:0010605	0.334	negative regulation of macromolecule metabolic process
GO:0031324	0.325	negative regulation of cellular metabolic process
GO:0008152	0.313	metabolic process
GO:0048583	0.313	regulation of response to stimulus
GO:0010558	0.312	negative regulation of macromolecule biosynthetic process
GO:0045934	0.309	negative regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0043232	0.806	intracellular non-membrane-bounded organelle
GO:0005737	0.732	cytoplasm
GO:0005829	0.398	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]