StarFunc result for job id Q99807

User Input

>input (217 residues)
MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGE
YGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGF
ALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELE
HHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99807	1.000	1.000	2.350E-28	217	1.000	1.000	Q99807.pdb.gz	COQ7_HUMAN 5-demethoxyubiquinone hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=COQ7 PE=1 SV=3
2	AFDB:P97478	0.892	0.892	1.531E-24	217	0.853	0.853	P97478.pdb.gz	COQ7_MOUSE 5-demethoxyubiquinone hydroxylase, mitochondrial OS=Mus musculus OX=10090 GN=Coq7 PE=1 SV=3
3	PDB:7sssE	0.759	0.946	4.589E-19	173	0.797	1.000	7sssE.pdb.gz	Structure and functionality of a multimeric human COQ7:COQ9 complex.
4	AFDB:P48376	0.788	0.913	1.415E-15	187	0.456	0.529	P48376.pdb.gz	COQ7_CAEEL 5-demethoxyubiquinone hydroxylase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=clk-1 PE=1 SV=1
5	AFDB:O74826	0.788	0.792	3.715E-15	216	0.447	0.449	O74826.pdb.gz	COQ7_SCHPO 5-demethoxyubiquinone hydroxylase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=coq7 PE=3 SV=1
6	AFDB:P41735	0.768	0.716	1.843E-12	233	0.396	0.369	P41735.pdb.gz	COQ7_YEAST 5-demethoxyubiquinone hydroxylase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAT5 PE=1 SV=2
7	AFDB:Q9I5R6	0.694	0.701	2.070E-6	215	0.171	0.172	Q9I5R6.pdb.gz	COQ7_PSEAE 3-demethoxyubiquinol 3-hydroxylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=coq7 PE=1 SV=1
8	AFDB:F4KFT7	0.515	0.212	7.418E-3	617	0.134	0.047	F4KFT7.pdb.gz	TENAC_ARATH Bifunctional TH2 protein, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=TH2 PE=1 SV=1
9	AFDB:Q8N4E7	0.481	0.438	5.357E-2	242	0.166	0.149	Q8N4E7.pdb.gz	FTMT_HUMAN Ferritin, mitochondrial OS=Homo sapiens OX=9606 GN=FTMT PE=1 SV=1
10	AFDB:Q9D5H4	0.461	0.428	5.609E-2	237	0.166	0.152	Q9D5H4.pdb.gz	FTMT_MOUSE Ferritin, mitochondrial OS=Mus musculus OX=10090 GN=Ftmt PE=1 SV=2
11	AFDB:Q39101	0.497	0.431	5.873E-2	255	0.157	0.133	Q39101.pdb.gz	FRI1_ARATH Ferritin-1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FER1 PE=1 SV=1
12	PDB:7k26D	0.495	0.592	9.863E-2	176	0.134	0.165	7k26D.pdb.gz	Anisotropic Dynamics and Mechanics of Macromolecular Crystals Containing Lattice-Patterned Polymer Networks.
13	PDB:7tbhA	0.435	0.393	1.241E-1	243	0.115	0.103	7tbhA.pdb.gz	Cryo-EM, Protein Engineering, and Simulation Enable the Development of Peptide Therapeutics against Acute Myeloid Leukemia.
14	PDB:2fg8A	0.463	0.557	1.300E-1	174	0.124	0.155	2fg8A.pdb.gz
15	PDB:7o6eA	0.444	0.530	1.300E-1	177	0.097	0.119	7o6eA.pdb.gz
16	PDB:3bviF	0.495	0.608	1.361E-1	173	0.097	0.121	3bviF.pdb.gz	Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin
17	PDB:2wtlA	0.489	0.640	1.492E-1	161	0.115	0.155	2wtlA.pdb.gz	Crystal Structure of Bfra from Mycobacterium Tuberculosis:Incorporation of Selenomethionine Results in Cleavage and Demetallation of Haem
18	PDB:4e6kA	0.467	0.623	1.712E-1	157	0.106	0.146	4e6kA.pdb.gz	The Structure of the BfrB-Bfd Complex Reveals Protein-Protein Interactions Enabling Iron Release from Bacterioferritin.
19	PDB:5ls9F	0.481	0.608	1.877E-1	165	0.106	0.139	5ls9F.pdb.gz	Humanized archaeal ferritin as a tool for cell targeted delivery.
20	PDB:3vv9B	0.464	0.385	2.058E-1	268	0.115	0.093	3vv9B.pdb.gz	Structure of the trypanosome cyanide-insensitive alternative oxidase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99807	1.23e-162	449	217	1.000	1.000	COQ7_HUMAN 5-demethoxyubiquinone hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=COQ7 PE=1 SV=3
2	P97478	8.71e-132	371	217	0.853	0.853	COQ7_MOUSE 5-demethoxyubiquinone hydroxylase, mitochondrial OS=Mus musculus OX=10090 GN=Coq7 PE=1 SV=3
3	Q63619	3.31e-120	340	179	0.742	0.899	COQ7_RAT 5-demethoxyubiquinone hydroxylase, mitochondrial (Fragment) OS=Rattus norvegicus OX=10116 GN=Coq7 PE=2 SV=3
4	P48376	1.29e-69	213	187	0.447	0.519	COQ7_CAEEL 5-demethoxyubiquinone hydroxylase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=clk-1 PE=1 SV=1
5	O74826	8.57e-55	176	216	0.442	0.444	COQ7_SCHPO 5-demethoxyubiquinone hydroxylase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=coq7 PE=3 SV=1
6	P41735	5.71e-50	164	233	0.396	0.369	COQ7_YEAST 5-demethoxyubiquinone hydroxylase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAT5 PE=1 SV=2
7	Q9I5R6	8.13e-07	50.1	215	0.129	0.130	COQ7_PSEAE 3-demethoxyubiquinol 3-hydroxylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=coq7 PE=1 SV=1
8	Q1RMW2	3.1	31.2	414	0.115	0.060	T184A_BOVIN Transmembrane protein 184A OS=Bos taurus OX=9913 GN=TMEM184A PE=1 SV=1
9	Q9DB00	4.8	30.8	2260	0.060	0.006	GON4L_MOUSE GON-4-like protein OS=Mus musculus OX=10090 GN=Gon4l PE=1 SV=3
10	A0A0B4LF82	7.1	30.4	2060	0.065	0.007	A0A0B4LF82_DROME Sin3A, isoform H OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=1 SV=1
11	A0A0B4K765	7.3	30.0	2066	0.065	0.007	A0A0B4K765_DROME Sin3A, isoform G OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=1 SV=1
12	Q5U0Y0	7.3	30.0	2062	0.065	0.007	Q5U0Y0_DROME LD13852p OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=1 SV=1
13	O77025	7.4	30.0	2061	0.065	0.007	O77025_DROME Transcription factor OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=2 SV=1
14	O17142	7.5	30.0	1773	0.065	0.008	O17142_DROME Transcriptional co-repressor SIN3A OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=2 SV=1
15	A0A126GUN9	7.7	30.0	1786	0.065	0.008	A0A126GUN9_DROME Sin3A, isoform J OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=1 SV=1
16	O17143	7.7	30.0	1751	0.065	0.008	O17143_DROME Transcriptional co-repressor SIN3A OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=2 SV=1
17	A1Z927	7.8	30.0	1776	0.065	0.008	A1Z927_DROME Sin3A, isoform A OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=1 SV=1
18	A1Z928	7.8	30.0	1751	0.065	0.008	A1Z928_DROME Sin3A, isoform D OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=1 SV=1
19	A0A0B4LF93	7.9	30.0	1747	0.065	0.008	A0A0B4LF93_DROME Sin3A, isoform I OS=Drosophila melanogaster OX=7227 GN=Sin3A PE=1 SV=1
20	P49256	8.5	29.6	356	0.060	0.037	LMAN2_CANLF Vesicular integral-membrane protein VIP36 OS=Canis lupus familiaris OX=9615 GN=LMAN2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03232 COQ7	2.7e-69	243.6	Ubiquinone biosynthesis protein COQ7
2	PF01373 Glyco_hydro_14	5.4e+02	10.9	Glycosyl hydrolase family 14
3	PF02915 Rubrerythrin	8.3	18.3	Rubrerythrin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322316

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254759	0.997	Ubiquinone biosynthesis O-methyltransferase, mitochondrial
2	9606.ENSP00000262507	0.996	Ubiquinone biosynthesis protein COQ9, mitochondrial
3	9606.ENSP00000288532	0.996	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial
4	9606.ENSP00000333946	0.984	Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial
5	9606.ENSP00000300452	0.976	Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial
6	9606.ENSP00000355741	0.954	Atypical kinase COQ8A, mitochondrial
7	9606.ENSP00000315118	0.934	Atypical kinase COQ8B, mitochondrial
8	9606.ENSP00000310873	0.933	4-hydroxybenzoate polyprenyltransferase, mitochondrial
9	9606.ENSP00000365388	0.932	Decaprenyl-diphosphate synthase subunit 1
10	9606.ENSP00000378505	0.909	Dual specificity protein kinase CLK3
11	9606.ENSP00000358033	0.876	Decaprenyl-diphosphate synthase subunit 2
12	9606.ENSP00000387262	0.787	MICOS complex subunit MIC60
13	9606.ENSP00000306397	0.785	Cytochrome b-c1 complex subunit Rieske, mitochondrial
14	9606.ENSP00000262319	0.782	Telomere length regulation protein TEL2 homolog
15	9606.ENSP00000312587	0.767	Coenzyme Q-binding protein COQ10 homolog A, mitochondrial
16	9606.ENSP00000346255	0.734	Protein phosphatase which positively regulates biosynthesis of the ubiquinone, coenzyme Q . Dephosphorylates the ubiquinone biosynthesis protein COQ7 which is likely to lead to its activation
17	9606.ENSP00000363417	0.715	Cationic amino acid transporter 3
18	9606.ENSP00000238561	0.695	Uncharacterized aarF domain-containing protein kinase 1
19	9606.ENSP00000372390	0.689	Cationic amino acid transporter 4
20	9606.ENSP00000261070	0.668	Cytochrome c oxidase copper chaperone

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	0.999	chromatin binding
GO:0003824	0.865	catalytic activity
GO:0016491	0.446	oxidoreductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.993	organic substance metabolic process
GO:0044237	0.991	cellular metabolic process
GO:0009058	0.921	biosynthetic process
GO:0050896	0.905	response to stimulus
GO:0006744	0.887	ubiquinone biosynthetic process
GO:0065007	0.807	biological regulation
GO:0050794	0.798	regulation of cellular process
GO:0019222	0.731	regulation of metabolic process
GO:0031323	0.596	regulation of cellular metabolic process
GO:0071840	0.412	cellular component organization or biogenesis
GO:0042221	0.381	response to chemical
GO:0016043	0.371	cellular component organization
GO:0048518	0.351	positive regulation of biological process
GO:2000377	0.333	regulation of reactive oxygen species metabolic process
GO:0060255	0.318	regulation of macromolecule metabolic process
GO:0080090	0.311	regulation of primary metabolic process
GO:0051171	0.311	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.979	membrane
GO:0032991	0.915	protein-containing complex
GO:0005740	0.910	mitochondrial envelope
GO:0031966	0.899	mitochondrial membrane
GO:0005743	0.891	mitochondrial inner membrane
GO:0005634	0.864	nucleus
GO:0070013	0.759	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.446	Oxidoreductases.

[back to server]