StarFunc result for job id Q99814

User Input

>input (870 residues)
MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLA
ISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMG
LTQVELTGHSIFDFTHPCDHEEIRENLSLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRG
RTVNLKSATWKVLHCTGQVKVYNNCPPHNSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD
SKTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKG
QVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTE
SLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFGNQN
FEESSAYGKAILPPSQPWATELRSHSTQSEAGSLPAFTVPQAAAPGSTTPSATSSSSSCS
TPNSPEDYYTSLDNDLKIEVIEKLFAMDTEAKDQCSTQTDFNELDLETLAPYIPMDGEDF
QLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPE
HRPMSSIFFDAGSKASLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWAVGDQRTE
FLGAAPLGPPVSPPHVSTFKTRSAKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQ
DLSGGDPPGGSTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFTQNPMRGLGHPLRHL
PLPQPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELT
RYDCEVNVPVLGSSTLLQGGDLLRALDQAT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97481	0.544	0.542	0.000	874	0.883	0.879	P97481.pdb.gz	EPAS1_MOUSE Endothelial PAS domain-containing protein 1 OS=Mus musculus OX=10090 GN=Epas1 PE=1 SV=2
2	AFDB:Q99814	1.000	1.000	0.000	870	1.000	1.000	Q99814.pdb.gz	EPAS1_HUMAN Endothelial PAS domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EPAS1 PE=1 SV=3
3	AFDB:A0A2R8QI31	0.561	0.582	1.327E-84	836	0.579	0.603	A0A2R8QI31.pdb.gz
4	AFDB:E7FAJ1	0.453	0.467	6.687E-75	842	0.557	0.576	E7FAJ1.pdb.gz	E7FAJ1_DANRE Endothelial PAS domain protein 1a OS=Danio rerio OX=7955 GN=epas1a PE=4 SV=3
5	AFDB:F8W2W5	0.506	0.540	1.964E-72	810	0.524	0.563	F8W2W5.pdb.gz	F8W2W5_DANRE Endothelial PAS domain protein 1a OS=Danio rerio OX=7955 GN=epas1a PE=4 SV=1
6	AFDB:Q24167	0.363	0.212	1.070E-39	1507	0.247	0.143	Q24167.pdb.gz	SIMA_DROME Protein similar OS=Drosophila melanogaster OX=7227 GN=sima PE=1 SV=2
7	AFDB:F8VR32	0.337	0.314	5.290E-35	938	0.226	0.210	F8VR32.pdb.gz	F8VR32_HUMAN Neuronal PAS domain protein 3 OS=Homo sapiens OX=9606 GN=NPAS3 PE=1 SV=1
8	AFDB:E1JIM6	0.194	0.169	8.273E-26	1015	0.179	0.154	E1JIM6.pdb.gz	E1JIM6_DROME Spineless, isoform C OS=Drosophila melanogaster OX=7227 GN=ss PE=1 SV=2
9	AFDB:B3DH92	0.140	0.148	8.747E-26	820	0.167	0.177	B3DH92.pdb.gz	B3DH92_DANRE Clock circadian regulator b OS=Danio rerio OX=7955 GN=clock3 PE=2 SV=1
10	AFDB:Q8JIG3	0.141	0.145	2.017E-25	845	0.176	0.181	Q8JIG3.pdb.gz	Q8JIG3_DANRE BHLH-PAS transcription factor OS=Danio rerio OX=7955 GN=zfCLOCK2 PE=2 SV=1
11	PDB:6jt0A	0.112	0.159	6.293E-5	542	0.060	0.096	6jt0A.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
12	PDB:2wkpA	0.115	0.295	7.035E-5	320	0.033	0.091	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
13	PDB:7d9tA	0.104	0.155	1.918E-4	512	0.052	0.088	7d9tA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
14	PDB:7rzwB	0.110	0.111	9.125E-4	864	0.053	0.053	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.
15	PDB:6umzA	0.094	0.552	1.348E-3	127	0.008	0.055	6umzA.pdb.gz	Structural and spectroscopic characterization of photoactive yellow protein and photoswitchable fluorescent protein constructs containing heavy atoms.
16	PDB:6jt0B	0.094	0.129	2.630E-3	576	0.039	0.059	6jt0B.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
17	PDB:7q3dB	0.066	0.113	6.413E-3	453	0.036	0.068	7q3dB.pdb.gz
18	PDB:6jp8F	0.082	0.075	9.472E-3	973	0.024	0.022	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
19	PDB:7d9rA	0.084	0.136	1.954E-2	502	0.020	0.034	7d9rA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
20	PDB:7jsnA	0.048	0.050	3.411E-2	820	0.051	0.054	7jsnA.pdb.gz	Structure of the Visual Signaling Complex between Transducin and Phosphodiesterase 6.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8MYV6	0.0	623	827	0.376	0.395	A8MYV6_HUMAN Hypoxia-inducible factor 1-alpha OS=Homo sapiens OX=9606 GN=HIF1A PE=1 SV=1
2	B3DJD1	0.0	923	834	0.594	0.620	B3DJD1_DANRE Endothelial PAS domain protein 1b OS=Danio rerio OX=7955 GN=epas1 PE=2 SV=1
3	D0VY79	0.0	622	826	0.375	0.395	D0VY79_HUMAN Hypoxia-inducible factor 1-alpha OS=Homo sapiens OX=9606 GN=HIF1A PE=1 SV=1
4	D4A8P8	0.0	620	826	0.372	0.392	D4A8P8_RAT Hypoxia-inducible factor 1-alpha OS=Rattus norvegicus OX=10116 GN=Hif1a PE=4 SV=3
5	E7FAJ1	0.0	857	842	0.564	0.583	E7FAJ1_DANRE Endothelial PAS domain protein 1a OS=Danio rerio OX=7955 GN=epas1a PE=4 SV=3
6	F8W2W5	0.0	828	810	0.551	0.591	F8W2W5_DANRE Endothelial PAS domain protein 1a OS=Danio rerio OX=7955 GN=epas1a PE=4 SV=1
7	O35800	0.0	617	825	0.371	0.392	HIF1A_RAT Hypoxia-inducible factor 1-alpha OS=Rattus norvegicus OX=10116 GN=Hif1a PE=2 SV=1
8	P97481	0.0	1548	874	0.880	0.876	EPAS1_MOUSE Endothelial PAS domain-containing protein 1 OS=Mus musculus OX=10090 GN=Epas1 PE=1 SV=2
9	Q16665	0.0	622	826	0.375	0.395	HIF1A_HUMAN Hypoxia-inducible factor 1-alpha OS=Homo sapiens OX=9606 GN=HIF1A PE=1 SV=1
10	Q61221	0.0	625	836	0.378	0.394	HIF1A_MOUSE Hypoxia-inducible factor 1-alpha OS=Mus musculus OX=10090 GN=Hif1a PE=1 SV=3
11	Q6EHI4	0.0	604	777	0.382	0.427	Q6EHI4_DANRE Hypoxia-inducible factor 1-alpha OS=Danio rerio OX=7955 GN=hif1a PE=2 SV=1
12	Q99814	0.0	1809	870	1.000	1.000	EPAS1_HUMAN Endothelial PAS domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EPAS1 PE=1 SV=3
13	Q9JHS1	0.0	1514	874	0.860	0.856	EPAS1_RAT Endothelial PAS domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Epas1 PE=2 SV=1
14	Q9XTA5	0.0	635	823	0.449	0.475	HIF1A_BOVIN Hypoxia-inducible factor 1-alpha OS=Bos taurus OX=9913 GN=HIF1A PE=2 SV=1
15	A0A0R4IBR4	1.64e-149	456	626	0.289	0.401	A0A0R4IBR4_DANRE Hypoxia-inducible factor 1 subunit alpha,-like OS=Danio rerio OX=7955 GN=Hif-3alpha PE=4 SV=1
16	F1QNB9	6.11e-149	457	717	0.244	0.296	F1QNB9_DANRE Hypoxia-inducible factor 1 alpha A OS=Danio rerio OX=7955 GN=hif1aa PE=2 SV=2
17	A0A0R4IB28	4.27e-148	452	619	0.286	0.402	A0A0R4IB28_DANRE Hypoxia-inducible factor 1 subunit alpha,-like OS=Danio rerio OX=7955 GN=Hif-3alpha PE=4 SV=2
18	Q9Y2N7	9.10e-134	416	669	0.270	0.351	HIF3A_HUMAN Hypoxia-inducible factor 3-alpha OS=Homo sapiens OX=9606 GN=HIF3A PE=1 SV=2
19	Q9JHS2	5.37e-133	414	662	0.274	0.360	HIF3A_RAT Hypoxia-inducible factor 3-alpha OS=Rattus norvegicus OX=10116 GN=Hif3a PE=1 SV=1
20	Q0VBL6	6.09e-131	409	662	0.269	0.353	HIF3A_MOUSE Hypoxia-inducible factor 3-alpha OS=Mus musculus OX=10090 GN=Hif3a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03187 Corona_I	3.3e+02	12.3	Corona nucleocapsid I protein
2	PF11413 HIF-1	1.9e-13	60.8	Hypoxia-inducible factor-1
3	PF08778 HIF-1a_CTAD	7.4e-15	65.5	HIF-1 alpha C terminal transactivation domain
4	PF00010 HLH	2.5e+02	13.0	Helix-loop-helix DNA-binding domain
5	PF00989 PAS	5.8e-11	53.8	PAS fold
6	PF14598 PAS_11	2.5e-20	84.0	PAS domain
7	PF08447 PAS_3	1.1e-23	94.7	PAS fold
8	PF08448 PAS_4	0.00061	31.4	PAS fold
9	PF13426 PAS_9	0.00028	32.5	PAS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263734

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256474	0.999	Von Hippel-Lindau disease tumor suppressor
2	9606.ENSP00000351407	0.999	Aryl hydrocarbon receptor nuclear translocator
3	9606.ENSP00000355601	0.998	Egl nine homolog 1
4	9606.ENSP00000250457	0.992	Egl nine homolog 3
5	9606.ENSP00000262306	0.992	Elongin-B
6	9606.ENSP00000478121	0.992	Elongin-C
7	9606.ENSP00000469686	0.991	Egl nine homolog 2
8	9606.ENSP00000263253	0.990	Histone acetyltransferase p300
9	9606.ENSP00000262367	0.984	CREB-binding protein
10	9606.ENSP00000478570	0.978	Vascular endothelial growth factor A
11	9606.ENSP00000252723	0.965	Erythropoietin
12	9606.ENSP00000307479	0.963	Aryl hydrocarbon receptor nuclear translocator 2
13	9606.ENSP00000367608	0.960	Carbonic anhydrase 9
14	9606.ENSP00000212015	0.956	NAD-dependent protein deacetylase sirtuin-1
15	9606.ENSP00000299163	0.943	Hypoxia-inducible factor 1-alpha inhibitor
16	9606.ENSP00000323588	0.941	Transcription factor SOX-2
17	9606.ENSP00000229307	0.933	Homeobox protein NANOG
18	9606.ENSP00000444198	0.933	Cbp/p300-interacting transactivator 2
19	9606.ENSP00000442460	0.928	Protein-tyrosine kinase 6
20	9606.ENSP00000483825	0.911	NF-kappa-B essential modulator

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043565	1.000	sequence-specific DNA binding
GO:0046982	0.998	protein heterodimerization activity
GO:1990837	0.977	sequence-specific double-stranded DNA binding
GO:0000976	0.957	transcription cis-regulatory region binding
GO:0140110	0.913	transcription regulator activity
GO:0008134	0.882	transcription factor binding
GO:0140297	0.802	DNA-binding transcription factor binding
GO:0003700	0.795	DNA-binding transcription factor activity
GO:0001221	0.774	transcription coregulator binding
GO:0061629	0.730	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001223	0.716	transcription coactivator binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0019222	0.997	regulation of metabolic process
GO:0009987	0.989	cellular process
GO:0010468	0.988	regulation of gene expression
GO:0080090	0.987	regulation of primary metabolic process
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0031323	0.987	regulation of cellular metabolic process
GO:0010556	0.984	regulation of macromolecule biosynthetic process
GO:0048518	0.980	positive regulation of biological process
GO:0031326	0.980	regulation of cellular biosynthetic process
GO:0019219	0.973	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.961	regulation of DNA-templated transcription
GO:0001666	0.924	response to hypoxia
GO:0048522	0.922	positive regulation of cellular process
GO:0051716	0.920	cellular response to stimulus
GO:0010604	0.918	positive regulation of macromolecule metabolic process
GO:0051173	0.916	positive regulation of nitrogen compound metabolic process
GO:0031325	0.914	positive regulation of cellular metabolic process
GO:0006357	0.903	regulation of transcription by RNA polymerase II
GO:0045893	0.889	positive regulation of DNA-templated transcription
GO:0042221	0.880	response to chemical
GO:0007165	0.846	signal transduction
GO:0045944	0.824	positive regulation of transcription by RNA polymerase II
GO:0070887	0.723	cellular response to chemical stimulus
GO:0008152	0.677	metabolic process
GO:0032501	0.602	multicellular organismal process
GO:0032502	0.596	developmental process
GO:0071704	0.565	organic substance metabolic process
GO:0048856	0.556	anatomical structure development
GO:0048519	0.556	negative regulation of biological process
GO:0044237	0.506	cellular metabolic process
GO:0048523	0.499	negative regulation of cellular process
GO:0051246	0.480	regulation of protein metabolic process
GO:0006807	0.463	nitrogen compound metabolic process
GO:0044238	0.420	primary metabolic process
GO:0007275	0.412	multicellular organism development
GO:0031399	0.375	regulation of protein modification process
GO:0033554	0.373	cellular response to stress
GO:0043170	0.358	macromolecule metabolic process
GO:0009892	0.356	negative regulation of metabolic process
GO:0010605	0.353	negative regulation of macromolecule metabolic process
GO:0051239	0.335	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.998	nucleoplasm
GO:0032991	0.992	protein-containing complex
GO:0005829	0.870	cytosol
GO:0005667	0.713	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]