StarFunc result for job id Q99828

User Input

>input (191 residues)
MGGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILS
LPELKANPFKERICRVFSTSPAKDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDD
GTLNREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRS
PDFASSFKIVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VK09	0.984	0.984	3.941E-29	191	1.000	1.000	A0A140VK09.pdb.gz	A0A140VK09_HUMAN Testicular secretory protein Li 9 OS=Homo sapiens OX=9606 PE=2 SV=1
2	PDB:2l4hA	0.735	0.759	1.603E-21	184	0.963	1.000	2l4hA.pdb.gz	Solution Structures of Ca2+-CIB1 and Mg2+-CIB1 and Their Interactions with the Platelet Integrin {alpha}IIb Cytoplasmic Domain.
3	AFDB:Q9W2Q5	0.831	0.839	6.768E-15	189	0.445	0.450	Q9W2Q5.pdb.gz	Q9W2Q5_DROME Calcium and integrin binding family member 2 OS=Drosophila melanogaster OX=7227 GN=Cib2 PE=4 SV=3
4	AFDB:Q96Q77	0.887	0.905	1.407E-14	187	0.398	0.406	Q96Q77.pdb.gz	CIB3_HUMAN Calcium and integrin-binding family member 3 OS=Homo sapiens OX=9606 GN=CIB3 PE=1 SV=3
5	AFDB:O75838	0.873	0.890	2.133E-13	187	0.372	0.380	O75838.pdb.gz	CIB2_HUMAN Calcium and integrin-binding family member 2 OS=Homo sapiens OX=9606 GN=CIB2 PE=1 SV=1
6	AFDB:A0PJX0	0.845	0.870	2.629E-13	185	0.419	0.432	A0PJX0.pdb.gz	CIB4_HUMAN Calcium and integrin-binding family member 4 OS=Homo sapiens OX=9606 GN=CIB4 PE=1 SV=1
7	AFDB:Q6PC72	0.876	0.893	7.097E-13	187	0.382	0.390	Q6PC72.pdb.gz	Q6PC72_DANRE Calcium and integrin-binding family member 2 OS=Danio rerio OX=7955 GN=zgc:73079 PE=2 SV=1
8	PDB:6wu5B	0.785	0.818	3.436E-12	183	0.393	0.410	6wu5B.pdb.gz	CIB2 and CIB3 are auxiliary subunits of the mechanotransduction channel of hair cells.
9	AFDB:Q4QC21	0.788	0.853	4.886E-10	175	0.246	0.269	Q4QC21.pdb.gz	Q4QC21_LEIMA Putative calcineurin B subunit OS=Leishmania major OX=5664 GN=LMJF_21_1630 PE=3 SV=1
10	AFDB:P25296	0.743	0.805	1.543E-9	175	0.225	0.246	P25296.pdb.gz	CANB_YEAST Calcineurin subunit B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CNB1 PE=1 SV=3
11	AFDB:A0A1D8PP58	0.746	0.815	1.805E-9	173	0.257	0.283	A0A1D8PP58.pdb.gz	A0A1D8PP58_CANAL Calcineurin subunit B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CNB1 PE=3 SV=1
12	AFDB:Q55G87	0.756	0.798	3.562E-9	180	0.267	0.283	Q55G87.pdb.gz	CANB1_DICDI Calcineurin subunit B type 1 OS=Dictyostelium discoideum OX=44689 GN=cnbA PE=1 SV=1
13	PDB:6tz8B	0.689	0.749	1.077E-8	174	0.204	0.224	6tz8B.pdb.gz	Harnessing calcineurin-FK506-FKBP12 crystal structures from invasive fungal pathogens to develop antifungal agents.
14	PDB:2ct9B	0.700	0.677	5.739E-8	198	0.241	0.232	2ct9B.pdb.gz	Structural characterization of calcineurin B homologous protein 1
15	PDB:2zfdA	0.709	0.736	1.910E-7	183	0.257	0.268	2zfdA.pdb.gz	The crystal structure of plant-specific calcium-binding protein AtCBL2 in complex with the regulatory domain of AtCIPK14
16	PDB:5aanA	0.690	0.717	2.234E-7	183	0.230	0.240	5aanA.pdb.gz	Interference of the complex between NCS-1 and Ric8a with phenothiazines regulates synaptic function and is an approach for fragile X syndrome.
17	PDB:1v1fA	0.749	0.760	7.435E-7	188	0.209	0.213	1v1fA.pdb.gz	The Structure of the Arabidopsis Thaliana SOS3: Molecular Mechanism of Sensing Calcium for Salt Stress Response
18	PDB:7u0tA	0.666	0.670	7.834E-7	190	0.236	0.237	7u0tA.pdb.gz	Structure-Guided Synthesis of FK506 and FK520 Analogs with Increased Selectivity Exhibit In Vivo Therapeutic Efficacy against Cryptococcus.
19	PDB:1s1eA	0.699	0.732	1.716E-6	181	0.209	0.221	1s1eA.pdb.gz	Two N-terminal domains of Kv4 K(+) channels regulate binding to and modulation by KChIP1.
20	PDB:7ukhI	0.678	0.710	1.808E-6	181	0.194	0.204	7ukhI.pdb.gz	Activation and closed-state inactivation mechanisms of the human voltage-gated K V 4 channel complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VK09	1.78e-137	383	191	1.000	1.000	A0A140VK09_HUMAN Testicular secretory protein Li 9 OS=Homo sapiens OX=9606 PE=2 SV=1
2	Q99828	1.78e-137	383	191	1.000	1.000	CIB1_HUMAN Calcium and integrin-binding protein 1 OS=Homo sapiens OX=9606 GN=CIB1 PE=1 SV=4
3	Q9Z0F4	6.31e-128	359	191	0.937	0.937	CIB1_MOUSE Calcium and integrin-binding protein 1 OS=Mus musculus OX=10090 GN=Cib1 PE=1 SV=3
4	Q9R010	7.19e-128	359	191	0.937	0.937	CIB1_RAT Calcium and integrin-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Cib1 PE=1 SV=3
5	Q9W2Q5	2.38e-49	160	189	0.461	0.466	Q9W2Q5_DROME Calcium and integrin binding family member 2 OS=Drosophila melanogaster OX=7227 GN=Cib2 PE=4 SV=3
6	A0PJX0	6.54e-44	146	185	0.414	0.427	CIB4_HUMAN Calcium and integrin-binding family member 4 OS=Homo sapiens OX=9606 GN=CIB4 PE=1 SV=1
7	Q96Q77	6.40e-41	138	187	0.398	0.406	CIB3_HUMAN Calcium and integrin-binding family member 3 OS=Homo sapiens OX=9606 GN=CIB3 PE=1 SV=3
8	Q6PC72	4.31e-40	136	187	0.387	0.396	Q6PC72_DANRE Calcium and integrin-binding family member 2 OS=Danio rerio OX=7955 GN=zgc:73079 PE=2 SV=1
9	Q9Z309	2.19e-39	134	187	0.377	0.385	CIB2_MOUSE Calcium and integrin-binding family member 2 OS=Mus musculus OX=10090 GN=Cib2 PE=1 SV=1
10	Q568Z7	3.00e-39	134	187	0.377	0.385	CIB2_RAT Calcium and integrin-binding family member 2 OS=Rattus norvegicus OX=10116 GN=Cib2 PE=1 SV=1
11	O75838	4.43e-39	134	187	0.377	0.385	CIB2_HUMAN Calcium and integrin-binding family member 2 OS=Homo sapiens OX=9606 GN=CIB2 PE=1 SV=1
12	Q55G87	7.91e-19	81.6	180	0.257	0.272	CANB1_DICDI Calcineurin subunit B type 1 OS=Dictyostelium discoideum OX=44689 GN=cnbA PE=1 SV=1
13	Q9UU93	3.11e-18	79.7	174	0.262	0.287	CANB_SCHPO Calcineurin subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cnb1 PE=3 SV=1
14	Q6FLU4	3.46e-18	79.7	175	0.262	0.286	CANB_CANGA Calcineurin subunit B OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CNB1 PE=3 SV=1
15	P25296	8.44e-17	76.3	175	0.257	0.280	CANB_YEAST Calcineurin subunit B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CNB1 PE=1 SV=3
16	Q4QC21	1.21e-16	75.9	175	0.257	0.280	Q4QC21_LEIMA Putative calcineurin B subunit OS=Leishmania major OX=5664 GN=LMJF_21_1630 PE=3 SV=1
17	A0A1D8PP58	4.26e-16	74.3	173	0.241	0.266	A0A1D8PP58_CANAL Calcineurin subunit B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CNB1 PE=3 SV=1
18	B9WI58	4.26e-16	74.3	173	0.241	0.266	B9WI58_CANDC Calcineurin subunit B OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) OX=573826 GN=CNB1 PE=3 SV=1
19	P63098	7.05e-16	73.6	170	0.199	0.224	CANB1_HUMAN Calcineurin subunit B type 1 OS=Homo sapiens OX=9606 GN=PPP3R1 PE=1 SV=2
20	P63099	7.05e-16	73.6	170	0.199	0.224	CANB1_BOVIN Calcineurin subunit B type 1 OS=Bos taurus OX=9913 GN=PPP3R1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00404 Dockerin_1	1.7	20.2	Dockerin type I domain
2	PF00036 EF-hand_1	1.2e-07	41.8	EF hand
3	PF12763 EF-hand_4	1.1e+02	14.1	Cytoskeletal-regulatory complex EF hand
4	PF13202 EF-hand_5	0.00018	32.1	EF hand
5	PF13405 EF-hand_6	7.6e-06	36.4	EF-hand domain
6	PF13499 EF-hand_7	3.1e-09	48.5	EF-hand domain pair
7	PF13833 EF-hand_8	1.8e-06	38.9	EF-hand domain pair
8	PF10591 SPARC_Ca_bdg	63	15.3	Secreted protein acidic and rich in cysteine Ca binding region
9	PF01023 S_100	24	16.0	S-100/ICaBP type calcium binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000012735

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000015779	0.759	Integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)
2	9598.ENSPTRP00000006139	0.746	Uncharacterized protein
3	9598.ENSPTRP00000018747	0.717	Actinin, alpha 4
4	9598.ENSPTRP00000033293	0.716	Uncharacterized protein
5	9598.ENSPTRP00000027570	0.702	Translation factor GUF1, mitochondrial
6	9598.ENSPTRP00000043317	0.692	Mitogen-activated protein kinase kinase kinase 5
7	9598.ENSPTRP00000017607	0.684	Uncharacterized protein
8	9598.ENSPTRP00000004567	0.673	Serine/threonine-protein phosphatase
9	9598.ENSPTRP00000028026	0.673	Protein phosphatase 3, catalytic subunit, alpha isozyme
10	9598.ENSPTRP00000034353	0.673	Serine/threonine-protein phosphatase
11	9598.ENSPTRP00000027436	0.656	CD38 molecule
12	9598.ENSPTRP00000009405	0.649	Calcium binding protein 1
13	9598.ENSPTRP00000008631	0.624	Cyclin-dependent kinase 2
14	9598.ENSPTRP00000016499	0.607	Transmembrane channel-like 6
15	9598.ENSPTRP00000000400	0.604	Uncharacterized protein
16	9598.ENSPTRP00000001150	0.599	Uncharacterized protein
17	9598.ENSPTRP00000017860	0.598	Uncharacterized protein
18	9598.ENSPTRP00000043774	0.594	Low density lipoprotein receptor class A domain containing 4
19	9598.ENSPTRP00000051089	0.593	Presenilin
20	9598.ENSPTRP00000051495	0.592	Ring finger and WD repeat domain 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.998	enzyme binding
GO:0043167	0.996	ion binding
GO:0005509	0.986	calcium ion binding
GO:0019900	0.715	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050896	0.989	response to stimulus
GO:0050794	0.985	regulation of cellular process
GO:0048518	0.985	positive regulation of biological process
GO:0010646	0.979	regulation of cell communication
GO:0048522	0.973	positive regulation of cellular process
GO:0048523	0.965	negative regulation of cellular process
GO:0050848	0.957	regulation of calcium-mediated signaling
GO:0060341	0.915	regulation of cellular localization
GO:0032880	0.892	regulation of protein localization
GO:0051716	0.878	cellular response to stimulus
GO:0019222	0.878	regulation of metabolic process
GO:0031323	0.869	regulation of cellular metabolic process
GO:0060255	0.868	regulation of macromolecule metabolic process
GO:0007154	0.867	cell communication
GO:0080090	0.865	regulation of primary metabolic process
GO:0051171	0.865	regulation of nitrogen compound metabolic process
GO:0007165	0.863	signal transduction
GO:0070884	0.857	regulation of calcineurin-NFAT signaling cascade
GO:0050850	0.848	positive regulation of calcium-mediated signaling
GO:0032501	0.814	multicellular organismal process
GO:1903829	0.779	positive regulation of protein localization
GO:0008152	0.738	metabolic process
GO:0009893	0.727	positive regulation of metabolic process
GO:0042221	0.718	response to chemical
GO:0065009	0.700	regulation of molecular function
GO:0010604	0.692	positive regulation of macromolecule metabolic process
GO:0010033	0.666	response to organic substance
GO:0071704	0.657	organic substance metabolic process
GO:0051128	0.649	regulation of cellular component organization
GO:0032502	0.647	developmental process
GO:0051173	0.634	positive regulation of nitrogen compound metabolic process
GO:0031325	0.627	positive regulation of cellular metabolic process
GO:0044238	0.614	primary metabolic process
GO:0043170	0.595	macromolecule metabolic process
GO:0048856	0.583	anatomical structure development
GO:0006807	0.518	nitrogen compound metabolic process
GO:0044237	0.504	cellular metabolic process
GO:0051246	0.499	regulation of protein metabolic process
GO:0010468	0.483	regulation of gene expression
GO:0051174	0.481	regulation of phosphorus metabolic process
GO:0007275	0.479	multicellular organism development
GO:0006950	0.463	response to stress
GO:0051049	0.460	regulation of transport
GO:0019219	0.446	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.445	regulation of macromolecule biosynthetic process
GO:0031326	0.445	regulation of cellular biosynthetic process
GO:0071840	0.438	cellular component organization or biogenesis
GO:0019220	0.436	regulation of phosphate metabolic process
GO:0031399	0.435	regulation of protein modification process
GO:0051252	0.426	regulation of RNA metabolic process
GO:0050790	0.422	regulation of catalytic activity
GO:1903506	0.420	regulation of nucleic acid-templated transcription
GO:1905475	0.417	regulation of protein localization to membrane
GO:0006355	0.404	regulation of DNA-templated transcription
GO:1905477	0.399	positive regulation of protein localization to membrane
GO:0009892	0.395	negative regulation of metabolic process
GO:0031324	0.394	negative regulation of cellular metabolic process
GO:0016043	0.390	cellular component organization
GO:1903078	0.388	positive regulation of protein localization to plasma membrane
GO:0010810	0.361	regulation of cell-substrate adhesion
GO:0051172	0.339	negative regulation of nitrogen compound metabolic process
GO:0010605	0.339	negative regulation of macromolecule metabolic process
GO:0044260	0.336	cellular macromolecule metabolic process
GO:0007166	0.334	cell surface receptor signaling pathway
GO:0051179	0.327	localization
GO:0031400	0.327	negative regulation of protein modification process
GO:0042981	0.326	regulation of apoptotic process
GO:0044093	0.312	positive regulation of molecular function
GO:0042325	0.304	regulation of phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.995	membrane
GO:0005737	0.995	cytoplasm
GO:0005634	0.995	nucleus
GO:0071944	0.985	cell periphery
GO:0005886	0.983	plasma membrane
GO:0005654	0.977	nucleoplasm
GO:0005829	0.779	cytosol
GO:0005576	0.500	extracellular region
GO:0043005	0.465	neuron projection
GO:0012505	0.445	endomembrane system
GO:0043025	0.389	neuronal cell body
GO:0042383	0.364	sarcolemma
GO:0043232	0.323	intracellular non-membrane-bounded organelle
GO:0031982	0.307	vesicle
GO:0005615	0.304	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]