StarFunc result for job id Q99836

User Input

>input (296 residues)
MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLE
IRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQ
QQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIR
QLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFA
LSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99836	1.000	1.000	1.816E-55	296	1.000	1.000	Q99836.pdb.gz	MYD88_HUMAN Myeloid differentiation primary response protein MyD88 OS=Homo sapiens OX=9606 GN=MYD88 PE=1 SV=1
2	AFDB:P22366	0.730	0.730	7.066E-47	296	0.818	0.818	P22366.pdb.gz	MYD88_MOUSE Myeloid differentiation primary response protein MyD88 OS=Mus musculus OX=10090 GN=Myd88 PE=1 SV=3
3	AFDB:A5HNF6	0.577	0.571	1.267E-41	299	0.716	0.709	A5HNF6.pdb.gz	MYD88_CHICK Myeloid differentiation primary response protein MyD88 OS=Gallus gallus OX=9031 GN=MYD88 PE=1 SV=1
4	AFDB:Q5XJ85	0.625	0.649	4.607E-38	284	0.598	0.623	Q5XJ85.pdb.gz	MYD88_DANRE Myeloid differentiation primary response protein MyD88 OS=Danio rerio OX=7955 GN=myd88 PE=2 SV=2
5	AFDB:S6FDG5	0.596	0.621	1.028E-37	283	0.615	0.643	S6FDG5.pdb.gz	S6FDG5_ONCMY Myeloid differentiation primary response protein MyD88 OS=Oncorhynchus mykiss OX=8022 GN=MYD88 PE=4 SV=1
6	AFDB:Q7K105	0.480	0.272	4.051E-18	537	0.264	0.145	Q7K105.pdb.gz	Q7K105_DROME LD20892p OS=Drosophila melanogaster OX=7227 GN=Myd88 PE=1 SV=1
7	AFDB:Q9NBK8	0.402	0.155	2.203E-8	795	0.135	0.050	Q9NBK8.pdb.gz	Q9NBK8_DROME Toll-5 OS=Drosophila melanogaster OX=7227 GN=Tehao PE=2 SV=1
8	AFDB:P58753	0.404	0.532	2.471E-8	221	0.145	0.195	P58753.pdb.gz	TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adapter protein OS=Homo sapiens OX=9606 GN=TIRAP PE=1 SV=2
9	AFDB:Q9VLE6	0.403	0.112	2.771E-8	1125	0.220	0.058	Q9VLE6.pdb.gz	Q9VLE6_DROME Toll-4 OS=Drosophila melanogaster OX=7227 GN=Toll-4 PE=3 SV=3
10	AFDB:W8W3S0	0.410	0.123	4.916E-8	1027	0.179	0.052	W8W3S0.pdb.gz	W8W3S0_SALSA TLR20a protein OS=Salmo salar OX=8030 GN=TLR PE=2 SV=1
11	PDB:3j0aA	0.404	0.160	9.358E-7	797	0.098	0.036	3j0aA.pdb.gz	Toll-like receptor 5 forms asymmetric dimers in the absence of flagellin.
12	PDB:3jrnA	0.296	0.551	2.031E-3	151	0.081	0.159	3jrnA.pdb.gz
13	PDB:7jlxA	0.251	0.413	6.392E-3	166	0.091	0.163	7jlxA.pdb.gz
14	PDB:7ajuCL	0.239	0.098	1.694E-2	808	0.047	0.017	7ajuCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:7ajtCL	0.306	0.132	1.900E-2	781	0.061	0.023	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:4ivnA	0.224	0.246	2.012E-2	264	0.118	0.133	4ivnA.pdb.gz	Structural insights into the regulation of sialic acid catabolism by the Vibrio vulnificus transcriptional repressor NanR
17	PDB:7wtlCL	0.297	0.159	2.012E-2	610	0.078	0.038	7wtlCL.pdb.gz	In vitro structural maturation of an early stage pre-40S particle coupled with U3 snoRNA release and central pseudoknot formation.
18	PDB:7qooM	0.279	0.424	2.838E-2	176	0.068	0.114	7qooM.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
19	PDB:1t0iA	0.206	0.311	4.490E-2	185	0.054	0.086	1t0iA.pdb.gz	Crystal Structure and Functional Characterization of Yeast YLR011wp, an Enzyme with NAD(P)H-FMN and Ferric Iron Reductase Activities
20	PDB:2nshA	0.232	0.361	7.965E-2	163	0.074	0.135	2nshA.pdb.gz	N(5)-CAIR Mutase: Role of a CO(2) Binding Site and Substrate Movement in Catalysis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99836	0.0	608	296	1.000	1.000	MYD88_HUMAN Myeloid differentiation primary response protein MyD88 OS=Homo sapiens OX=9606 GN=MYD88 PE=1 SV=1
2	Q6Y1S1	2.71e-174	485	296	0.818	0.818	MYD88_RAT Myeloid differentiation primary response protein MyD88 OS=Rattus norvegicus OX=10116 GN=Myd88 PE=2 SV=2
3	P22366	6.10e-173	481	296	0.818	0.818	MYD88_MOUSE Myeloid differentiation primary response protein MyD88 OS=Mus musculus OX=10090 GN=Myd88 PE=1 SV=3
4	A5HNF6	2.09e-150	425	299	0.716	0.709	MYD88_CHICK Myeloid differentiation primary response protein MyD88 OS=Gallus gallus OX=9031 GN=MYD88 PE=1 SV=1
5	S6FDG5	3.18e-131	375	283	0.615	0.643	S6FDG5_ONCMY Myeloid differentiation primary response protein MyD88 OS=Oncorhynchus mykiss OX=8022 GN=MYD88 PE=4 SV=1
6	B3SRQ2	2.68e-130	373	283	0.611	0.640	MYD88_SALSA Myeloid differentiation primary response protein MyD88 OS=Salmo salar OX=8030 GN=myd88 PE=2 SV=1
7	Q5XJ85	8.47e-128	367	284	0.598	0.623	MYD88_DANRE Myeloid differentiation primary response protein MyD88 OS=Danio rerio OX=7955 GN=myd88 PE=2 SV=2
8	Q4LBC6	8.89e-124	357	282	0.588	0.617	MYD88_ONCMY Myeloid differentiation primary response protein MyD88 OS=Oncorhynchus mykiss OX=8022 GN=myd88 PE=2 SV=1
9	B2KNI9	5.15e-34	120	72	0.186	0.764	B2KNI9_SALSA Myeloid differentiation factor 88 (Fragment) OS=Salmo salar OX=8030 GN=MyD88 PE=2 SV=1
10	Q7K105	1.36e-20	93.6	537	0.267	0.147	Q7K105_DROME LD20892p OS=Drosophila melanogaster OX=7227 GN=Myd88 PE=1 SV=1
11	Q9QUK6	4.06e-09	59.7	835	0.139	0.049	TLR4_MOUSE Toll-like receptor 4 OS=Mus musculus OX=10090 GN=Tlr4 PE=1 SV=1
12	Q9QX05	9.34e-09	58.5	835	0.139	0.049	TLR4_RAT Toll-like receptor 4 OS=Rattus norvegicus OX=10116 GN=Tlr4 PE=2 SV=1
13	P08953	1.55e-08	58.2	1097	0.135	0.036	TOLL_DROME Protein toll OS=Drosophila melanogaster OX=7227 GN=Tl PE=1 SV=1
14	Q9VIA4	1.70e-08	57.8	965	0.128	0.039	Q9VIA4_DROME MstProx OS=Drosophila melanogaster OX=7227 GN=MstProx PE=4 SV=3
15	Q9V477	7.49e-08	55.8	1346	0.155	0.034	TOLL8_DROME Toll-like receptor Tollo OS=Drosophila melanogaster OX=7227 GN=Tollo PE=1 SV=1
16	P58753	1.29e-07	53.5	221	0.145	0.195	TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adapter protein OS=Homo sapiens OX=9606 GN=TIRAP PE=1 SV=2
17	Q9VJX9	1.64e-07	54.7	795	0.115	0.043	Q9VJX9_DROME Tehao, isoform A OS=Drosophila melanogaster OX=7227 GN=Tehao PE=3 SV=1
18	Q9NBK8	1.66e-07	54.7	795	0.115	0.043	Q9NBK8_DROME Toll-5 OS=Drosophila melanogaster OX=7227 GN=Tehao PE=2 SV=1
19	Q6TS42	2.13e-07	54.3	788	0.139	0.052	Q6TS42_DANRE Toll-like receptor 2 OS=Danio rerio OX=7955 GN=tlr2 PE=2 SV=1
20	O00206	2.20e-07	54.3	839	0.139	0.049	TLR4_HUMAN Toll-like receptor 4 OS=Homo sapiens OX=9606 GN=TLR4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00531 Death	9.2e-11	53.1	Death domain
2	PF01582 TIR	1.5e-10	52.6	TIR domain
3	PF13676 TIR_2	3.5e-09	48.7	TIR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000015673

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000005053	0.999	Interleukin-1 receptor-associated kinase 4
2	9601.ENSPPYP00000023353	0.999	Interleukin-1 receptor-associated kinase 1
3	9601.ENSPPYP00000003845	0.998	TNF receptor-associated factor 6, E3 ubiquitin protein ligase
4	9601.ENSPPYP00000013505	0.998	Interleukin 1 receptor, type I
5	9601.ENSPPYP00000021908	0.996	Belongs to the Toll-like receptor family.
6	9601.ENSPPYP00000015274	0.994	Binds to the IL-1 type I receptor following IL-1 engagement, triggering intracellular signaling cascades leading to transcriptional up-regulation and mRNA stabilization
7	9601.ENSPPYP00000004627	0.991	Toll-interleukin 1 receptor (TIR) domain containing adaptor protein
8	9601.ENSPPYP00000016388	0.991	Toll-like receptor 6
9	9601.ENSPPYP00000016387	0.990	Belongs to the Toll-like receptor family.
10	9601.ENSPPYP00000016910	0.986	Toll-like receptor 2
11	9601.ENSPPYP00000022512	0.985	Belongs to the Toll-like receptor family.
12	9601.ENSPPYP00000003370	0.977	Toll interacting protein
13	9601.ENSPPYP00000020954	0.977	Lymphocyte antigen 96
14	9601.ENSPPYP00000003337	0.964	Interferon regulatory factor 7
15	9601.ENSPPYP00000017042	0.964	Belongs to the Toll-like receptor family.
16	9601.ENSPPYP00000003427	0.962	FAS-associated death domain protein
17	9601.ENSPPYP00000007003	0.958	Belongs to the TNF receptor-associated factor family.
18	9601.ENSPPYP00000016112	0.955	Interleukin-1 receptor accessory protein precursor
19	9601.ENSPPYP00000005399	0.943	Interleukin-1 receptor-associated kinase 3
20	9601.ENSPPYP00000018861	0.937	Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. Plays an important role in the cascades of cellular responses evoked by changes in the environment. Mediates signal transduction of TRAF6, various cytokines including interleukin-1 (IL-1), transforming growth factor-beta (TGFB), TGFB-related factors like BMP2 and BMP4, toll-like receptors (TLR), tumor necrosis factor receptor CD40 and B-cell receptor (BCR). Ceramides are also able to activate MAP3K7/TAK1. Once activated, acts as an upstream activator of the MKK/JNK signal transdu [...]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005126	0.999	cytokine receptor binding
GO:0043621	0.994	protein self-association
GO:0042802	0.984	identical protein binding
GO:0019904	0.893	protein domain specific binding
GO:0032813	0.862	tumor necrosis factor receptor superfamily binding
GO:0005123	0.746	death receptor binding
GO:0003824	0.692	catalytic activity
GO:0140096	0.499	catalytic activity, acting on a protein
GO:0070851	0.463	growth factor receptor binding
GO:0005149	0.364	interleukin-1 receptor binding
GO:0097159	0.323	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.985	biological regulation
GO:0048518	0.978	positive regulation of biological process
GO:0007165	0.978	signal transduction
GO:0031347	0.956	regulation of defense response
GO:1902533	0.956	positive regulation of intracellular signal transduction
GO:0065009	0.955	regulation of molecular function
GO:0060255	0.949	regulation of macromolecule metabolic process
GO:0043122	0.944	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0051092	0.935	positive regulation of NF-kappaB transcription factor activity
GO:0010604	0.933	positive regulation of macromolecule metabolic process
GO:0002221	0.930	pattern recognition receptor signaling pathway
GO:0001819	0.922	positive regulation of cytokine production
GO:0043123	0.921	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0019221	0.917	cytokine-mediated signaling pathway
GO:0045087	0.910	innate immune response
GO:0002224	0.852	toll-like receptor signaling pathway
GO:0002237	0.833	response to molecule of bacterial origin
GO:0009615	0.823	response to virus
GO:1901700	0.787	response to oxygen-containing compound
GO:0070555	0.767	response to interleukin-1
GO:0048519	0.745	negative regulation of biological process
GO:0048523	0.721	negative regulation of cellular process
GO:0035556	0.718	intracellular signal transduction
GO:0032760	0.681	positive regulation of tumor necrosis factor production
GO:0051179	0.649	localization
GO:0033554	0.647	cellular response to stress
GO:0008152	0.612	metabolic process
GO:0032677	0.611	regulation of interleukin-8 production
GO:0010605	0.589	negative regulation of macromolecule metabolic process
GO:0071704	0.566	organic substance metabolic process
GO:0032757	0.564	positive regulation of interleukin-8 production
GO:0044237	0.541	cellular metabolic process
GO:0044238	0.536	primary metabolic process
GO:1900015	0.526	regulation of cytokine production involved in inflammatory response
GO:0006807	0.513	nitrogen compound metabolic process
GO:0065008	0.478	regulation of biological quality
GO:0043170	0.466	macromolecule metabolic process
GO:0031325	0.433	positive regulation of cellular metabolic process
GO:0051173	0.428	positive regulation of nitrogen compound metabolic process
GO:0032501	0.376	multicellular organismal process
GO:0032675	0.312	regulation of interleukin-6 production
GO:1901564	0.309	organonitrogen compound metabolic process
GO:0006954	0.309	inflammatory response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005829	0.999	cytosol
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005886	0.992	plasma membrane
GO:0005634	0.945	nucleus
GO:0012505	0.800	endomembrane system
GO:0031090	0.500	organelle membrane
GO:0031982	0.408	vesicle
GO:0097708	0.399	intracellular vesicle
GO:0031410	0.384	cytoplasmic vesicle
GO:0005768	0.343	endosome
GO:0098588	0.342	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]