StarFunc result for job id Q99853

User Input

>input (325 residues)
MPRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNS
LRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKVLKSDHLAPS
KPADAAQYLQQQAKLRLSALAASGTHLPQMPAAAYNLGGVAQPSGFKHPFAIENIIAREY
KMPGGLAFSAMQPVPAAYPLPNQLTTMGSSLGTGWPHVYGSAGMIDSATPISMASGDYSA
YGVPLKPLCHAAGQTLPAIPVPIKPTPAAVPALPALPAPIPTLLSNSPPSLSPTSSQTAT
SQSSPATPSETLTSPASALHSVAVH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q64732	0.434	0.434	3.738E-51	325	0.997	0.997	Q64732.pdb.gz	FOXB1_MOUSE Forkhead box protein B1 OS=Mus musculus OX=10090 GN=Foxb1 PE=2 SV=2
2	AFDB:O93529	0.379	0.385	5.721E-42	319	0.837	0.853	O93529.pdb.gz	FOXB1_XENLA Forkhead box protein B1 OS=Xenopus laevis OX=8355 GN=foxb1 PE=2 SV=1
3	AFDB:O73779	0.426	0.460	5.337E-41	297	0.800	0.875	O73779.pdb.gz	O73779_DANRE Fork head domain protein FKD3 OS=Danio rerio OX=7955 GN=foxb1.2 PE=2 SV=1
4	AFDB:O73781	0.381	0.410	3.742E-34	299	0.695	0.756	O73781.pdb.gz
5	AFDB:P34683	0.341	0.464	4.631E-21	237	0.332	0.456	P34683.pdb.gz	LIN31_CAEEL Protein lin-31 OS=Caenorhabditis elegans OX=6239 GN=lin-31 PE=4 SV=1
6	AFDB:Q91765	0.335	0.253	2.231E-19	434	0.338	0.253	Q91765.pdb.gz	FXA2A_XENLA Forkhead box protein A2-A OS=Xenopus laevis OX=8355 GN=foxa2-a PE=1 SV=1
7	AFDB:P55317	0.335	0.232	1.153E-18	472	0.335	0.231	P55317.pdb.gz	FOXA1_HUMAN Hepatocyte nuclear factor 3-alpha OS=Homo sapiens OX=9606 GN=FOXA1 PE=1 SV=2
8	AFDB:P32183	0.346	0.319	1.314E-18	354	0.280	0.257	P32183.pdb.gz	FOXA3_RAT Hepatocyte nuclear factor 3-gamma OS=Rattus norvegicus OX=10116 GN=Foxa3 PE=1 SV=1
9	AFDB:P79772	0.335	0.277	1.404E-18	394	0.320	0.264	P79772.pdb.gz	FOXD3_CHICK Forkhead box protein D3 OS=Gallus gallus OX=9031 GN=FOXD3 PE=2 SV=1
10	AFDB:Q9PTK2	0.312	0.278	1.825E-18	365	0.338	0.301	Q9PTK2.pdb.gz	FOXE4_XENLA Forkhead box protein E4 OS=Xenopus laevis OX=8355 GN=foxe4 PE=2 SV=1
11	PDB:2hdcA	0.244	0.673	1.453E-10	97	0.200	0.670	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
12	PDB:7k5yU	0.184	0.610	3.535E-2	75	0.046	0.200	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
13	PDB:4yrvA	0.121	0.134	4.597E-2	288	0.049	0.056	4yrvA.pdb.gz	Structural insights into HetR-PatS interaction involved in cyanobacterial pattern formation
14	PDB:5k1yD	0.168	0.521	4.597E-2	92	0.034	0.120	5k1yD.pdb.gz	Detailed structural analysis of AspA-DNA contacts
15	PDB:3euhB	0.212	0.215	4.910E-2	321	0.031	0.031	3euhB.pdb.gz
16	PDB:5h3rA	0.188	0.391	5.599E-2	141	0.043	0.099	5h3rA.pdb.gz	Structural characterization of the DNA-binding mechanism underlying the copper(II)-sensing MarR transcriptional regulator.
17	PDB:2qbyB	0.173	0.155	6.385E-2	368	0.040	0.035	2qbyB.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
18	PDB:6iwtA	0.175	0.166	6.385E-2	346	0.046	0.043	6iwtA.pdb.gz
19	PDB:7a6hO	0.130	0.089	7.775E-2	512	0.049	0.031	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
20	PDB:2fe3B	0.164	0.334	1.231E-1	143	0.025	0.056	2fe3B.pdb.gz	Crystal structure of the apo-PerR-Zn protein from Bacillus subtilis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O93529	0.0	520	319	0.837	0.853	FOXB1_XENLA Forkhead box protein B1 OS=Xenopus laevis OX=8355 GN=foxb1 PE=2 SV=1
2	Q64732	0.0	658	325	0.997	0.997	FOXB1_MOUSE Forkhead box protein B1 OS=Mus musculus OX=10090 GN=Foxb1 PE=2 SV=2
3	Q99853	0.0	659	325	1.000	1.000	FOXB1_HUMAN Forkhead box protein B1 OS=Homo sapiens OX=9606 GN=FOXB1 PE=1 SV=3
4	O73779	4.26e-178	496	297	0.806	0.882	O73779_DANRE Fork head domain protein FKD3 OS=Danio rerio OX=7955 GN=foxb1.2 PE=2 SV=1
5	O93312	3.57e-156	440	296	0.729	0.801	O93312_DANRE Forkhead box B1b OS=Danio rerio OX=7955 GN=foxb1.1 PE=2 SV=1
6	P34683	1.12e-55	182	237	0.246	0.338	LIN31_CAEEL Protein lin-31 OS=Caenorhabditis elegans OX=6239 GN=lin-31 PE=4 SV=1
7	Q91765	4.57e-55	187	434	0.240	0.180	FXA2A_XENLA Forkhead box protein A2-A OS=Xenopus laevis OX=8355 GN=foxa2-a PE=1 SV=1
8	Q07342	6.20e-55	186	409	0.246	0.196	FOXA2_DANRE Forkhead box protein A2 OS=Danio rerio OX=7955 GN=foxa2 PE=2 SV=1
9	P35583	9.69e-55	187	459	0.255	0.181	FOXA2_MOUSE Hepatocyte nuclear factor 3-beta OS=Mus musculus OX=10090 GN=Foxa2 PE=1 SV=2
10	O73778	2.59e-54	185	441	0.237	0.175	O73778_DANRE Fork head domain protein FKD2 OS=Danio rerio OX=7955 GN=fkd2 PE=2 SV=1
11	O73843	3.12e-54	182	324	0.246	0.247	O73843_SALSA Fork head domain protein OS=Salmo salar OX=8030 GN=fkh PE=2 SV=1
12	B0ZTD4	6.35e-54	184	463	0.240	0.168	B0ZTD4_HUMAN Forkhead box A2 OS=Homo sapiens OX=9606 GN=FOXA2 PE=4 SV=1
13	Q9Y261	6.41e-54	184	457	0.240	0.171	FOXA2_HUMAN Hepatocyte nuclear factor 3-beta OS=Homo sapiens OX=9606 GN=FOXA2 PE=1 SV=1
14	P14734	8.50e-54	185	510	0.237	0.151	FKH_DROME Protein fork head OS=Drosophila melanogaster OX=7227 GN=fkh PE=1 SV=1
15	P33205	7.04e-53	180	399	0.255	0.208	FXA4A_XENLA Forkhead box protein A4-A OS=Xenopus laevis OX=8355 GN=foxa4-a PE=1 SV=3
16	Q17381	8.77e-53	182	506	0.240	0.154	PHA4_CAEEL Defective pharyngeal development protein 4 OS=Caenorhabditis elegans OX=6239 GN=pha-4 PE=1 SV=1
17	P55318	1.40e-52	178	350	0.240	0.223	FOXA3_HUMAN Hepatocyte nuclear factor 3-gamma OS=Homo sapiens OX=9606 GN=FOXA3 PE=1 SV=2
18	Q6P0C9	6.17e-52	179	427	0.231	0.176	Q6P0C9_DANRE Forkhead box A1 OS=Danio rerio OX=7955 GN=fkd7 PE=2 SV=1
19	P32183	7.92e-52	176	354	0.237	0.218	FOXA3_RAT Hepatocyte nuclear factor 3-gamma OS=Rattus norvegicus OX=10116 GN=Foxa3 PE=1 SV=1
20	P55317	1.04e-51	179	472	0.228	0.157	FOXA1_HUMAN Hepatocyte nuclear factor 3-alpha OS=Homo sapiens OX=9606 GN=FOXA1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	1.6e-33	126.0	Forkhead domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 118797.XP_007458947.1

Rank	PPI partner	STRING score	Description
1	118797.XP_007460556.1	0.566	Short stature homeobox protein isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	0.997	sequence-specific double-stranded DNA binding
GO:0003700	0.994	DNA-binding transcription factor activity
GO:0005515	0.969	protein binding
GO:0000976	0.949	transcription cis-regulatory region binding
GO:0000981	0.726	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.664	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.363	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.993	anatomical structure development
GO:0032501	0.988	multicellular organismal process
GO:0048731	0.938	system development
GO:0065007	0.934	biological regulation
GO:0007399	0.929	nervous system development
GO:0050789	0.921	regulation of biological process
GO:0050794	0.839	regulation of cellular process
GO:0048513	0.836	animal organ development
GO:0009987	0.676	cellular process
GO:0007417	0.633	central nervous system development
GO:0019222	0.557	regulation of metabolic process
GO:0051171	0.552	regulation of nitrogen compound metabolic process
GO:0080090	0.546	regulation of primary metabolic process
GO:0060255	0.546	regulation of macromolecule metabolic process
GO:0031323	0.544	regulation of cellular metabolic process
GO:0060322	0.529	head development
GO:0019219	0.500	regulation of nucleobase-containing compound metabolic process
GO:2001141	0.492	regulation of RNA biosynthetic process
GO:0006355	0.482	regulation of DNA-templated transcription
GO:0050896	0.418	response to stimulus
GO:0007420	0.383	brain development
GO:0048519	0.380	negative regulation of biological process
GO:0048523	0.331	negative regulation of cellular process
GO:0048518	0.317	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]