StarFunc result for job id Q99865

User Input

>input (258 residues)
MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQKKQRGRPSSQPRRNIVGCRISHGWKE
GDEPITQWKGTVLDQVPINPSLYLVKYDGIDCVYGLELHRDERVLSLKILSDRVASSHIS
DANLANTIIGKAVEHMFEGEHGSKDEWRGMVLAQAPIMKAWFYITYEKDPVLYMYQLLDD
YKEGDLRIMPESSESPPTEREPGGVVDGLIGKHVEYTKEDGSKRIGMVIHQVETKPSVYF
IKFDDDFHIYVYDLVKKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R9W1	0.844	0.844	4.965E-45	258	1.000	1.000	A0A024R9W1.pdb.gz
2	AFDB:A0A024R297	0.822	0.810	2.260E-39	262	0.779	0.767	A0A024R297.pdb.gz
3	AFDB:Q5JUX0	0.810	0.810	1.677E-38	258	0.740	0.740	Q5JUX0.pdb.gz	SPIN3_HUMAN Spindlin-3 OS=Homo sapiens OX=9606 GN=SPIN3 PE=1 SV=1
4	AFDB:Q56A73	0.778	0.806	1.183E-34	249	0.632	0.655	Q56A73.pdb.gz	SPIN4_HUMAN Spindlin-4 OS=Homo sapiens OX=9606 GN=SPIN4 PE=1 SV=1
5	PDB:2ns2A	0.756	0.966	5.359E-33	201	0.651	0.836	2ns2A.pdb.gz	Structure of human spindlin1. Tandem tudor-like domains for cell cycle regulation
6	PDB:2ns2B	0.656	0.979	1.975E-27	172	0.566	0.849	2ns2B.pdb.gz	Structure of human spindlin1. Tandem tudor-like domains for cell cycle regulation
7	AFDB:A0A087X074	0.252	0.397	5.057E-18	157	0.609	1.000	A0A087X074.pdb.gz	A0A087X074_HUMAN Spindlin family member 2A OS=Homo sapiens OX=9606 GN=SPIN2A PE=3 SV=1
8	AFDB:O94875	0.159	0.051	2.481E-5	1100	0.128	0.030	O94875.pdb.gz	SRBS2_HUMAN Sorbin and SH3 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SORBS2 PE=1 SV=3
9	AFDB:O60504	0.157	0.074	1.050E-3	671	0.109	0.042	O60504.pdb.gz	VINEX_HUMAN Vinexin OS=Homo sapiens OX=9606 GN=SORBS3 PE=1 SV=2
10	AFDB:Q95PX0	0.172	0.118	1.367E-3	397	0.128	0.083	Q95PX0.pdb.gz	Q95PX0_CAEEL NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family OS=Caenorhabditis elegans OX=6239 GN=nck-1 PE=1 SV=2
11	AFDB:Q75JD4	0.157	0.082	1.977E-3	533	0.105	0.051	Q75JD4.pdb.gz	Y1676_DICDI SH3 and F-BAR domain-containing protein DDB_G0271676 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271676 PE=4 SV=1
12	AFDB:F4JP43	0.155	0.029	4.846E-3	2037	0.128	0.016	F4JP43.pdb.gz	F4JP43_ARATH G2484-1 protein OS=Arabidopsis thaliana OX=3702 GN=G2484-1 PE=1 SV=1
13	PDB:3mh5A	0.148	0.176	6.078E-3	191	0.058	0.079	3mh5A.pdb.gz	HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues
14	PDB:2p4bB	0.120	0.119	8.341E-3	260	0.081	0.081	2p4bB.pdb.gz
15	PDB:7okyZ	0.210	0.159	1.030E-2	374	0.097	0.067	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
16	PDB:1te0A	0.123	0.106	1.840E-2	318	0.140	0.113	1te0A.pdb.gz
17	PDB:3pv2B	0.143	0.116	3.465E-2	388	0.155	0.103	3pv2B.pdb.gz
18	PDB:1zq1A	0.209	0.133	4.059E-2	437	0.066	0.039	1zq1A.pdb.gz	Structural Basis for tRNA-Dependent Amidotransferase Function
19	PDB:1ky9B	0.130	0.097	4.755E-2	396	0.062	0.040	1ky9B.pdb.gz
20	PDB:3gdvA	0.141	0.129	8.495E-2	296	0.112	0.098	3gdvA.pdb.gz	OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5JZB8	0.0	513	247	0.953	0.996	Q5JZB8_HUMAN Spindlin-2B (Fragment) OS=Homo sapiens OX=9606 GN=SPIN2B PE=1 SV=1
2	Q99865	0.0	537	258	1.000	1.000	SPI2A_HUMAN Spindlin-2A OS=Homo sapiens OX=9606 GN=SPIN2A PE=1 SV=3
3	Q9BPZ2	0.0	535	258	0.996	0.996	SPI2B_HUMAN Spindlin-2B OS=Homo sapiens OX=9606 GN=SPIN2B PE=1 SV=1
4	Q9Y657	9.47e-150	420	262	0.779	0.767	SPIN1_HUMAN Spindlin-1 OS=Homo sapiens OX=9606 GN=SPIN1 PE=1 SV=3
5	Q90WG2	1.64e-149	419	262	0.783	0.771	SPINW_CHICK Spindlin-W OS=Gallus gallus OX=9031 GN=SPINW PE=2 SV=1
6	Q61142	1.95e-149	419	262	0.775	0.763	SPIN1_MOUSE Spindlin-1 OS=Mus musculus OX=10090 GN=Spin1 PE=1 SV=2
7	Q5JUX0	4.38e-148	416	258	0.740	0.740	SPIN3_HUMAN Spindlin-3 OS=Homo sapiens OX=9606 GN=SPIN3 PE=1 SV=1
8	Q56A73	1.89e-118	340	249	0.624	0.647	SPIN4_HUMAN Spindlin-4 OS=Homo sapiens OX=9606 GN=SPIN4 PE=1 SV=1
9	A0A087X074	2.15e-54	174	157	0.322	0.529	A0A087X074_HUMAN Spindlin family member 2A OS=Homo sapiens OX=9606 GN=SPIN2A PE=3 SV=1
10	Q5JZB7	1.03e-53	172	157	0.318	0.522	Q5JZB7_HUMAN Spindlin family member 2B OS=Homo sapiens OX=9606 GN=SPIN2B PE=1 SV=1
11	Q9HAP2	7.2	30.4	919	0.097	0.027	MLXIP_HUMAN MLX-interacting protein OS=Homo sapiens OX=9606 GN=MLXIP PE=1 SV=2
12	Q9VXR3	9.8	30.4	5146	0.047	0.002	Q9VXR3_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=2
13	X2JC16	9.8	30.4	5150	0.047	0.002	X2JC16_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=1
14	X2JKH9	9.8	30.4	5127	0.047	0.002	X2JKH9_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=1
15	X2JF73	9.9	30.0	5151	0.047	0.002	X2JF73_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=1
16	X2JF83	9.9	30.0	5101	0.047	0.002	X2JF83_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=1
17	X2JFK0	9.9	30.0	5145	0.047	0.002	X2JFK0_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02513 Spin-Ssty	3.9e-72	249.1	Spin/Ssty Family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364043

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296870	0.518	Interleukin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035064	1.000	methylated histone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0071704	0.984	organic substance metabolic process
GO:0044238	0.983	primary metabolic process
GO:0006807	0.978	nitrogen compound metabolic process
GO:0050794	0.972	regulation of cellular process
GO:0043170	0.970	macromolecule metabolic process
GO:0044237	0.966	cellular metabolic process
GO:0019222	0.927	regulation of metabolic process
GO:0048522	0.916	positive regulation of cellular process
GO:0032501	0.894	multicellular organismal process
GO:0060255	0.890	regulation of macromolecule metabolic process
GO:0080090	0.876	regulation of primary metabolic process
GO:0051171	0.876	regulation of nitrogen compound metabolic process
GO:0031323	0.876	regulation of cellular metabolic process
GO:0006996	0.809	organelle organization
GO:0007276	0.769	gamete generation
GO:0046483	0.766	heterocycle metabolic process
GO:0010468	0.753	regulation of gene expression
GO:0009059	0.727	macromolecule biosynthetic process
GO:0016070	0.726	RNA metabolic process
GO:0010467	0.722	gene expression
GO:0007143	0.710	female meiotic nuclear division
GO:0044249	0.694	cellular biosynthetic process
GO:0098781	0.554	ncRNA transcription
GO:0034660	0.477	ncRNA metabolic process
GO:0048583	0.451	regulation of response to stimulus
GO:0023051	0.425	regulation of signaling
GO:0010646	0.358	regulation of cell communication
GO:0051173	0.350	positive regulation of nitrogen compound metabolic process
GO:0031325	0.350	positive regulation of cellular metabolic process
GO:0010604	0.349	positive regulation of macromolecule metabolic process
GO:0006355	0.326	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]