StarFunc result for job id Q99873

User Input

>input (371 residues)
MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHF
GIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECS
SISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYA
RDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVV
DPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTG
FSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLC
ELSCSTDYRMR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99873	1.000	1.000	4.511E-80	371	1.000	1.000	Q99873.pdb.gz	ANM1_HUMAN Protein arginine N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=PRMT1 PE=1 SV=3
2	AFDB:Q803D9	0.880	0.864	4.649E-69	378	0.836	0.820	Q803D9.pdb.gz
3	AFDB:Q9NR22	0.868	0.817	8.993E-68	394	0.763	0.718	Q9NR22.pdb.gz	ANM8_HUMAN Protein arginine N-methyltransferase 8 OS=Homo sapiens OX=9606 GN=PRMT8 PE=1 SV=2
4	PDB:6nt2A	0.860	0.965	4.147E-67	330	0.889	1.000	6nt2A.pdb.gz	Anti-tumor Activity of the Type I PRMT Inhibitor, GSK3368715, Synergizes with PRMT5 Inhibition through MTAP Loss.
5	AFDB:Q5RGQ2	0.858	0.761	7.270E-65	419	0.725	0.642	Q5RGQ2.pdb.gz	ANM8B_DANRE Protein arginine N-methyltransferase 8-B OS=Danio rerio OX=7955 GN=prmt8b PE=2 SV=2
6	AFDB:Q9VGW7	0.899	0.887	2.564E-62	376	0.631	0.622	Q9VGW7.pdb.gz	Q9VGW7_DROME Arginine methyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=Art1 PE=1 SV=1
7	AFDB:Q9U2X0	0.888	0.946	5.306E-60	348	0.615	0.655	Q9U2X0.pdb.gz	ANM1_CAEEL Protein arginine N-methyltransferase 1 OS=Caenorhabditis elegans OX=6239 GN=prmt-1 PE=1 SV=1
8	AFDB:Q9SU94	0.883	0.840	8.805E-56	390	0.534	0.508	Q9SU94.pdb.gz	ANM11_ARATH Protein arginine N-methyltransferase 1.1 OS=Arabidopsis thaliana OX=3702 GN=PRMT11 PE=1 SV=1
9	AFDB:Q9URX7	0.878	0.958	8.014E-53	340	0.523	0.571	Q9URX7.pdb.gz	ANM1_SCHPO Protein arginine N-methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rmt1 PE=1 SV=2
10	AFDB:C8V494	0.864	0.928	1.632E-52	345	0.518	0.557	C8V494.pdb.gz	C8V494_EMENI RmtA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10526 PE=4 SV=1
11	AFDB:Q4GYA9	0.861	0.925	5.153E-49	345	0.482	0.519	Q4GYA9.pdb.gz	Q4GYA9_TRYB2 Arginine N-methyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4690 PE=1 SV=1
12	PDB:6dnzA	0.836	0.977	1.595E-46	317	0.450	0.527	6dnzA.pdb.gz	Structural Basis of Protein Arginine Methyltransferase Activation by a Catalytically Dead Homolog (Prozyme).
13	PDB:1g6q1	0.825	0.931	5.626E-44	328	0.423	0.479	1g6q1.pdb.gz
14	PDB:4y2hB	0.770	0.809	1.133E-37	352	0.310	0.327	4y2hB.pdb.gz	Aryl Pyrazoles as Potent Inhibitors of Arginine Methyltransferases: Identification of the First PRMT6 Tool Compound.
15	PDB:3r0qG	0.786	0.825	5.333E-36	353	0.299	0.314	3r0qG.pdb.gz	Crystal structure of the plant epigenetic protein arginine methyltransferase 10.
16	PDB:6dnzB	0.750	0.865	3.956E-29	319	0.226	0.263	6dnzB.pdb.gz	Structural Basis of Protein Arginine Methyltransferase Activation by a Catalytically Dead Homolog (Prozyme).
17	PDB:4lwpB	0.658	0.711	1.783E-25	342	0.275	0.298	4lwpB.pdb.gz	Crystal Structure of Arginine Methyltransferase 6 from Trypanosoma brucei
18	PDB:4c4aA	0.605	0.366	6.891E-19	641	0.175	0.101	4c4aA.pdb.gz	Structural Insight Into Arginine Methylation by the Mouse Protein Arginine Methyltransferase 7: A Zinc Finger Freezes the Mimic of the Dimeric State Into a Single Active Site.
19	PDB:4g56A	0.633	0.396	8.734E-19	617	0.159	0.096	4g56A.pdb.gz	Structure of the arginine methyltransferase PRMT5-MEP50 reveals a mechanism for substrate specificity
20	PDB:7bo7AAA	0.635	0.392	5.208E-17	625	0.164	0.098	7bo7AAA.pdb.gz	CRYSTAL STRUCTURE OF THE HUMAN PRMT5:MEP50 COMPLEX with JNJB44355437

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1R3J9	0.0	663	348	0.830	0.885	F1R3J9_DANRE Protein arginine N-methyltransferase 1 OS=Danio rerio OX=7955 GN=fb39h07 PE=1 SV=1
2	Q5RGQ2	0.0	582	419	0.704	0.623	ANM8B_DANRE Protein arginine N-methyltransferase 8-B OS=Danio rerio OX=7955 GN=prmt8b PE=2 SV=2
3	Q63009	0.0	726	353	0.949	0.997	ANM1_RAT Protein arginine N-methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Prmt1 PE=1 SV=1
4	Q6VRB0	0.0	690	351	0.876	0.926	ANM1B_XENLA Protein arginine N-methyltransferase 1-B OS=Xenopus laevis OX=8355 GN=prmt1-b PE=1 SV=1
5	Q8AV13	0.0	719	369	0.914	0.919	ANM1A_XENLA Protein arginine N-methyltransferase 1-A OS=Xenopus laevis OX=8355 GN=prmt1-a PE=1 SV=1
6	Q99873	0.0	778	371	1.000	1.000	ANM1_HUMAN Protein arginine N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=PRMT1 PE=1 SV=3
7	Q9JIF0	0.0	776	371	0.997	0.997	ANM1_MOUSE Protein arginine N-methyltransferase 1 OS=Mus musculus OX=10090 GN=Prmt1 PE=1 SV=1
8	Q9NR22	0.0	608	394	0.757	0.713	ANM8_HUMAN Protein arginine N-methyltransferase 8 OS=Homo sapiens OX=9606 GN=PRMT8 PE=1 SV=2
9	Q9VGW7	0.0	516	376	0.625	0.617	Q9VGW7_DROME Arginine methyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=Art1 PE=1 SV=1
10	Q9U2X0	4.28e-170	479	348	0.601	0.641	ANM1_CAEEL Protein arginine N-methyltransferase 1 OS=Caenorhabditis elegans OX=6239 GN=prmt-1 PE=1 SV=1
11	H0YDE4	2.21e-163	458	238	0.601	0.937	H0YDE4_HUMAN Protein arginine methyltransferase 1 (Fragment) OS=Homo sapiens OX=9606 GN=PRMT1 PE=1 SV=1
12	Q9SU94	1.78e-146	421	390	0.536	0.510	ANM11_ARATH Protein arginine N-methyltransferase 1.1 OS=Arabidopsis thaliana OX=3702 GN=PRMT11 PE=1 SV=1
13	Q9URX7	5.61e-135	390	340	0.509	0.556	ANM1_SCHPO Protein arginine N-methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rmt1 PE=1 SV=2
14	C8V494	4.22e-134	388	345	0.523	0.562	C8V494_EMENI RmtA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10526 PE=4 SV=1
15	Q4GYA9	2.43e-113	335	345	0.472	0.507	Q4GYA9_TRYB2 Arginine N-methyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4690 PE=1 SV=1
16	P38074	1.09e-112	334	348	0.429	0.457	HMT1_YEAST Protein arginine N-methyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HMT1 PE=1 SV=1
17	Q5A943	6.21e-112	332	339	0.447	0.490	Q5A943_CANAL Protein-arginine omega-N methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HMT1 PE=4 SV=1
18	O60678	6.13e-110	333	531	0.426	0.298	ANM3_HUMAN Protein arginine N-methyltransferase 3 OS=Homo sapiens OX=9606 GN=PRMT3 PE=1 SV=4
19	O70467	5.48e-106	323	528	0.426	0.299	ANM3_RAT Protein arginine N-methyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Prmt3 PE=1 SV=1
20	Q922H1	1.42e-105	322	528	0.426	0.299	ANM3_MOUSE Protein arginine N-methyltransferase 3 OS=Mus musculus OX=10090 GN=Prmt3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02353 CMAS	13	16.6	Mycolic acid cyclopropane synthetase
2	PF08123 DOT1	8.1	17.4	Histone methylation protein DOT1
3	PF02527 GidB	2.6e+02	12.3	rRNA small subunit methyltransferase G
4	PF08241 Methyltransf_11	0.00056	31.8	Methyltransferase domain
5	PF08242 Methyltransf_12	1.3e+02	14.7	Methyltransferase domain
6	PF10294 Methyltransf_16	95	14.2	Lysine methyltransferase
7	PF13489 Methyltransf_23	0.051	24.9	Methyltransferase domain
8	PF13649 Methyltransf_25	4.9e-05	35.2	Methyltransferase domain
9	PF13847 Methyltransf_31	0.054	24.8	Methyltransferase domain
10	PF08003 Methyltransf_9	0.51	20.8	Protein of unknown function (DUF1698)
11	PF02475 Met_10	1.8	19.8	Met-10+ like-protein
12	PF05175 MTS	0.11	23.7	Methyltransferase small domain
13	PF01135 PCMT	46	15.2	Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
14	PF06325 PrmA	0.00015	32.9	Ribosomal protein L11 methyltransferase (PrmA)
15	PF05185 PRMT5	13	17.1	PRMT5 arginine-N-methyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 185453.XP_006868268.1

Rank	PPI partner	STRING score	Description
1	185453.XP_006835511.1	0.986	Protein arginine N-methyltransferase 5 isoform X1
2	185453.XP_006865980.1	0.952	Methylosome protein 50 isoform X1
3	185453.XP_006834177.1	0.950	Protein BTG2
4	185453.XP_006871588.1	0.944	rRNA 2'-O-methyltransferase fibrillarin
5	185453.XP_006874925.1	0.943	Small nuclear ribonucleoprotein-associated protein B'-like
6	185453.XP_006874988.1	0.929	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 12 Proteins
7	185453.XP_006865056.1	0.923	Methylosome subunit pICln
8	185453.XP_006871993.1	0.920	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins
9	185453.XP_006867350.1	0.915	Small nuclear ribonucleoprotein Sm D1
10	185453.XP_006862980.1	0.913	Small nuclear ribonucleoprotein G
11	185453.XP_006870787.1	0.912	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 mRNAs, 10 Proteins
12	185453.XP_006866939.1	0.906	Histone acetyltransferase p300
13	185453.XP_006862036.1	0.904	Ribosome biogenesis protein WDR12
14	185453.XP_006832388.1	0.902	Notchless protein homolog 1
15	185453.XP_006834793.1	0.900	tRNA (guanine(10)-N2)-methyltransferase homolog
16	185453.XP_006872872.1	0.899	Histone H4-like isoform X1
17	185453.XP_006872880.1	0.899	Histone H3.1-like
18	185453.XP_006872936.1	0.899	Uncharacterized protein LOC102825438
19	185453.XP_006872944.1	0.899	Uncharacterized protein LOC102829273
20	185453.XP_006865306.1	0.898	Periodic tryptophan protein 1 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016274	0.998	protein-arginine N-methyltransferase activity
GO:0042054	0.997	histone methyltransferase activity
GO:0005515	0.996	protein binding
GO:0008469	0.913	histone arginine N-methyltransferase activity
GO:0042802	0.873	identical protein binding
GO:1901363	0.690	heterocyclic compound binding
GO:0097159	0.690	organic cyclic compound binding
GO:0035242	0.673	protein-arginine omega-N asymmetric methyltransferase activity
GO:0003676	0.627	nucleic acid binding
GO:0035241	0.433	protein-arginine omega-N monomethyltransferase activity
GO:0140939	0.395	histone H4 methyltransferase activity
GO:0043167	0.392	ion binding
GO:1904047	0.357	S-adenosyl-L-methionine binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0006807	0.991	nitrogen compound metabolic process
GO:0043170	0.989	macromolecule metabolic process
GO:0065007	0.935	biological regulation
GO:0032501	0.889	multicellular organismal process
GO:0050789	0.886	regulation of biological process
GO:0044260	0.880	cellular macromolecule metabolic process
GO:0050794	0.875	regulation of cellular process
GO:0032502	0.869	developmental process
GO:0032259	0.861	methylation
GO:0008213	0.830	protein alkylation
GO:0019222	0.671	regulation of metabolic process
GO:0060255	0.625	regulation of macromolecule metabolic process
GO:0048518	0.588	positive regulation of biological process
GO:0043414	0.557	macromolecule methylation
GO:0051171	0.550	regulation of nitrogen compound metabolic process
GO:0048856	0.524	anatomical structure development
GO:0080090	0.520	regulation of primary metabolic process
GO:0031323	0.504	regulation of cellular metabolic process
GO:0006479	0.476	protein methylation
GO:0048522	0.453	positive regulation of cellular process
GO:0009889	0.413	regulation of biosynthetic process
GO:0007275	0.405	multicellular organism development
GO:0010468	0.401	regulation of gene expression
GO:0006725	0.383	cellular aromatic compound metabolic process
GO:0034641	0.380	cellular nitrogen compound metabolic process
GO:0071840	0.379	cellular component organization or biogenesis
GO:0046483	0.378	heterocycle metabolic process
GO:1901360	0.375	organic cyclic compound metabolic process
GO:0006139	0.372	nucleobase-containing compound metabolic process
GO:0010556	0.362	regulation of macromolecule biosynthetic process
GO:0019219	0.356	regulation of nucleobase-containing compound metabolic process
GO:0090304	0.352	nucleic acid metabolic process
GO:0031326	0.346	regulation of cellular biosynthetic process
GO:0018193	0.345	peptidyl-amino acid modification
GO:0009893	0.340	positive regulation of metabolic process
GO:0051252	0.339	regulation of RNA metabolic process
GO:0010604	0.302	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.997	protein-containing complex
GO:0005737	0.968	cytoplasm
GO:0005829	0.960	cytosol
GO:0005654	0.937	nucleoplasm
GO:0016020	0.718	membrane
GO:0043232	0.391	intracellular non-membrane-bounded organelle
GO:1902494	0.342	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	0.998	Methyltransferases.
RHEA:48096	0.673	L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine
EC:2.1.1.319	0.673	type I protein arginine methyltransferase.
RHEA:48100	0.433	L-arginyl-[protein] + S-adenosyl-L-methionine = H(+) + N(omega)-methyl-L-arginyl-[protein] + S-adenosyl-L-homocysteine
EC:2.1.1.321	0.433	type III protein arginine methyltransferase.

[back to server]