StarFunc result for job id Q99933

User Input

>input (345 residues)
MAQRGGARRPRGDRERLGSRLRALRPGREPRQSEPPAQRGPPPSGRPPARSTASGHDRPT
RGAAAGARRPRMKKKTRRRSTRSEELTRSEELTLSEEATWSEEATQSEEATQGEEMNRSQ
EVTRDEESTRSEEVTREEMAAAGLTVTVTHSNEKHDLHVTSQQGSSEPVVQDLAQVVEEV
IGVPQSFQKLIFKGKSLKEMETPLSALGIQDGCRVMLIGKKNSPQEEVELKKLKHLEKSV
EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPEN
FKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:J3QTA2	0.502	0.502	3.764E-49	345	0.997	0.997	J3QTA2.pdb.gz	J3QTA2_HUMAN BAG family molecular chaperone regulator 1 OS=Homo sapiens OX=9606 GN=BAG1 PE=1 SV=1
2	PDB:3dbhI	0.202	0.738	2.262E-5	86	0.049	0.198	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
3	PDB:3ai5A	0.203	0.233	5.590E-5	299	0.052	0.060	3ai5A.pdb.gz
4	PDB:3plvA	0.206	0.834	7.558E-5	80	0.043	0.188	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
5	PDB:7rbsB	0.199	0.419	1.022E-4	157	0.058	0.127	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
6	PDB:3tixA	0.209	0.430	1.085E-4	153	0.043	0.098	3tixA.pdb.gz
7	PDB:6mdhA	0.197	0.439	2.108E-4	149	0.046	0.107	6mdhA.pdb.gz
8	PDB:6yvaC	0.204	0.438	3.627E-4	155	0.055	0.123	6yvaC.pdb.gz
9	PDB:6ef3u	0.187	0.769	5.209E-4	75	0.052	0.240	6ef3u.pdb.gz	Substrate-engaged 26Sproteasome structures reveal mechanisms for ATP-hydrolysis-driven translocation.
10	PDB:4pyuA	0.204	0.843	6.631E-4	76	0.032	0.145	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
11	PDB:2k1fA	0.197	0.625	8.965E-4	88	0.023	0.091	2k1fA.pdb.gz
12	AFDB:O55098	0.133	0.056	2.351E-3	966	0.165	0.059	O55098.pdb.gz	STK10_MOUSE Serine/threonine-protein kinase 10 OS=Mus musculus OX=10090 GN=Stk10 PE=1 SV=2
13	AFDB:P41697	0.206	0.104	2.993E-3	788	0.151	0.066	P41697.pdb.gz	BUD6_YEAST Bud site selection protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BUD6 PE=1 SV=1
14	AFDB:O13735	0.164	0.053	3.377E-3	1385	0.130	0.032	O13735.pdb.gz	FAT1_SCHPO Actin-interacting protein 3 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fat1 PE=1 SV=2
15	AFDB:O45818	0.181	0.068	4.849E-3	1070	0.096	0.031	O45818.pdb.gz	DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans OX=6239 GN=dkf-2 PE=1 SV=4
16	AFDB:Q93YR9	0.168	0.094	7.397E-3	670	0.104	0.054	Q93YR9.pdb.gz	ARFP_ARATH Auxin response factor 16 OS=Arabidopsis thaliana OX=3702 GN=ARF16 PE=1 SV=1
17	AFDB:Q9H2G2	0.099	0.033	1.352E-2	1235	0.168	0.047	Q9H2G2.pdb.gz	SLK_HUMAN STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK PE=1 SV=1
18	AFDB:Q6AI12	0.197	0.186	2.063E-2	368	0.096	0.090	Q6AI12.pdb.gz	ANR40_HUMAN Ankyrin repeat domain-containing protein 40 OS=Homo sapiens OX=9606 GN=ANKRD40 PE=1 SV=2
19	AFDB:Q03386	0.178	0.074	2.962E-2	895	0.090	0.035	Q03386.pdb.gz	GNDS_RAT Ral guanine nucleotide dissociation stimulator OS=Rattus norvegicus OX=10116 GN=Ralgds PE=1 SV=1
20	AFDB:A0JC82	0.148	0.103	3.147E-2	519	0.119	0.079	A0JC82.pdb.gz	A0JC82_9HYPO NADPH oxidase regulator NoxR OS=Epichloe festucae OX=35717 GN=noxR PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J3QTA2	0.0	691	345	0.997	0.997	J3QTA2_HUMAN BAG family molecular chaperone regulator 1 OS=Homo sapiens OX=9606 GN=BAG1 PE=1 SV=1
2	Q99933	0.0	692	345	1.000	1.000	BAG1_HUMAN BAG family molecular chaperone regulator 1 OS=Homo sapiens OX=9606 GN=BAG1 PE=1 SV=4
3	Q60739	8.13e-170	478	355	0.730	0.710	BAG1_MOUSE BAG family molecular chaperone regulator 1 OS=Mus musculus OX=10090 GN=Bag1 PE=1 SV=3
4	B0K019	9.10e-169	476	358	0.722	0.696	BAG1_RAT BAG family molecular chaperone regulator 1 OS=Rattus norvegicus OX=10116 GN=Bag1 PE=2 SV=1
5	C9JYK5	3.67e-95	281	150	0.417	0.960	C9JYK5_HUMAN BAG cochaperone 1 (Fragment) OS=Homo sapiens OX=9606 GN=BAG1 PE=1 SV=2
6	O44739	3.94e-06	49.3	210	0.128	0.210	BAG1_CAEEL BAG family molecular chaperone regulator 1 OS=Caenorhabditis elegans OX=6239 GN=bag-1 PE=1 SV=1
7	Q8IHP3	0.010	40.4	2055	0.067	0.011	Q8IHP3_PLAF7 Membrane associated erythrocyte binding-like protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1147800.1 PE=4 SV=1
8	P48510	0.057	37.4	373	0.067	0.062	DSK2_YEAST Ubiquitin domain-containing protein DSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSK2 PE=1 SV=2
9	Q8RX71	0.059	37.4	269	0.116	0.149	BAG4_ARATH BAG family molecular chaperone regulator 4 OS=Arabidopsis thaliana OX=3702 GN=BAG4 PE=1 SV=1
10	O60125	0.12	35.8	195	0.064	0.113	BAG1A_SCHPO BAG family molecular chaperone regulator 1A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bag101 PE=2 SV=1
11	P47179	0.15	36.6	1161	0.067	0.020	DAN4_YEAST Cell wall protein DAN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DAN4 PE=2 SV=1
12	Q8R526	0.16	36.6	2615	0.081	0.011	PK1L1_MOUSE Polycystin-1-like protein 1 OS=Mus musculus OX=10090 GN=Pkd1l1 PE=1 SV=2
13	Q8I4Z1	0.19	36.2	1846	0.067	0.012	Q8I4Z1_PLAF7 Double C2-like domain-containing protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1243900 PE=4 SV=1
14	Q0WUQ1	0.33	35.0	342	0.122	0.123	BAG1_ARATH BAG family molecular chaperone regulator 1 OS=Arabidopsis thaliana OX=3702 GN=BAG1 PE=1 SV=1
15	C0H4R1	0.36	35.4	2279	0.038	0.006	C0H4R1_PLAF7 Adenylyl cyclase beta OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0802600 PE=4 SV=1
16	P87244	0.40	35.0	759	0.061	0.028	ALP16_SCHPO Spindle pole body component alp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alp16 PE=1 SV=1
17	Q949Y0	0.82	33.9	482	0.043	0.031	UBP6_ARATH Ubiquitin carboxyl-terminal hydrolase 6 OS=Arabidopsis thaliana OX=3702 GN=UBP6 PE=1 SV=1
18	O14562	0.93	33.5	309	0.055	0.061	UBFD1_HUMAN Ubiquitin domain-containing protein UBFD1 OS=Homo sapiens OX=9606 GN=UBFD1 PE=1 SV=2
19	Q6DD33	1.2	33.1	264	0.099	0.129	DCK2_XENLA Deoxycytidine kinase 2 OS=Xenopus laevis OX=8355 GN=dck.2 PE=1 SV=1
20	Q5ZJM7	1.5	32.7	265	0.096	0.125	DCK2_CHICK Deoxycytidine kinase 2 OS=Gallus gallus OX=9031 GN=DCK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02179 BAG	0.072	25.0	BAG domain
2	PF16888 DUF5082	50	15.6	Domain of unknown function (DUF5082)
3	PF00240 ubiquitin	0.0004	31.4	Ubiquitin family
4	PF14560 Ubiquitin_2	3.2e+02	13.2	Ubiquitin-like domain
5	PF18037 Ubiquitin_5	29	16.4	Ubiquitin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000420514

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302961	0.999	Heat shock protein family A member 4
2	9606.ENSP00000432083	0.999	Heat shock cognate 71 kDa protein
3	9606.ENSP00000219548	0.993	E3 ubiquitin-protein ligase CHIP
4	9606.ENSP00000364802	0.989	Heat shock 70 kDa protein 1A
5	9606.ENSP00000359727	0.980	BAG family molecular chaperone regulator 2
6	9606.ENSP00000364801	0.971	Heat shock protein family A member 1B
7	9606.ENSP00000324173	0.954	78 kDa glucose-regulated protein
8	9606.ENSP00000378199	0.952	Heat shock-related 70 kDa protein 2
9	9606.ENSP00000255631	0.948	Hsp70-binding protein 1
10	9606.ENSP00000231509	0.943	Glucocorticoid receptor
11	9606.ENSP00000358081	0.940	BAG family molecular chaperone regulator 3
12	9606.ENSP00000364805	0.938	Heat shock 70 kDa protein 1-like
13	9606.ENSP00000297185	0.937	Stress-70 protein, mitochondrial
14	9606.ENSP00000360266	0.934	Transcription factor AP-1
15	9606.ENSP00000310219	0.931	Heat shock 70 kDa protein 6
16	9606.ENSP00000367623	0.926	Heat shock 70 kDa protein 14
17	9606.ENSP00000358211	0.923	Heat shock protein family A member 12A
18	9606.ENSP00000254963	0.922	Heat shock protein family A member 12B
19	9606.ENSP00000285667	0.914	Heat shock 70 kDa protein 13
20	9606.ENSP00000296464	0.913	Heat shock 70 kDa protein 4L

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.996	heterocyclic compound binding
GO:0097159	0.996	organic cyclic compound binding
GO:0019899	0.970	enzyme binding
GO:0098772	0.902	molecular function regulator activity
GO:0044389	0.830	ubiquitin-like protein ligase binding
GO:0060590	0.768	ATPase regulator activity
GO:1901265	0.721	nucleoside phosphate binding
GO:0036094	0.680	small molecule binding
GO:0031625	0.660	ubiquitin protein ligase binding
GO:0003676	0.331	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0043067	0.998	regulation of programmed cell death
GO:0050896	0.996	response to stimulus
GO:0048523	0.990	negative regulation of cellular process
GO:0042981	0.990	regulation of apoptotic process
GO:0060548	0.984	negative regulation of cell death
GO:0007165	0.980	signal transduction
GO:0006457	0.979	protein folding
GO:0043066	0.967	negative regulation of apoptotic process
GO:0061077	0.890	chaperone-mediated protein folding
GO:0006458	0.878	'de novo' protein folding
GO:0051084	0.619	'de novo' post-translational protein folding
GO:0019222	0.562	regulation of metabolic process
GO:0048518	0.553	positive regulation of biological process
GO:0008152	0.499	metabolic process
GO:0060255	0.493	regulation of macromolecule metabolic process
GO:0048522	0.437	positive regulation of cellular process
GO:0071704	0.432	organic substance metabolic process
GO:0006807	0.400	nitrogen compound metabolic process
GO:0044238	0.388	primary metabolic process
GO:0080090	0.384	regulation of primary metabolic process
GO:0051171	0.384	regulation of nitrogen compound metabolic process
GO:0043170	0.366	macromolecule metabolic process
GO:0031323	0.345	regulation of cellular metabolic process
GO:0042221	0.336	response to chemical
GO:0044237	0.331	cellular metabolic process
GO:1901564	0.326	organonitrogen compound metabolic process
GO:0007166	0.326	cell surface receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.995	nucleoplasm
GO:0032991	0.579	protein-containing complex
GO:0043232	0.341	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]