StarFunc result for job id Q99941

User Input

>input (703 residues)
MAELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDG
SSLDVGMDVSPSEPPWELLPIFPDLQVKSEPSSPCSSSSLSSESSRLSTEPSSEALGVGE
VLHVKTESLAPPLCLLGDDPTSSFETVQINVIPTSDDSSDVQTKIEPVSPCSSVNSEASL
LSADSSSQAFIGEEVLEVKTESLSPSGCLLWDVPAPSLGAVQISMGPSLDGSSGKALPTR
KPPLQPKPVVLTTVPMPSRAVPPSTTVLLQSLVQPPPVSPVVLIQGAIRVQPEGPAPSLP
RPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAV
LADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPP
SAPISPRMNKGEPQPRRHLLGFSEQEPVQGVEPLQGSSQGPKEPQPSPTDQPSFSNLTAF
PGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKS
QPRKKSPPVKAVPIQPPGPPERDSVGQLQLYRHPDRSQPAFLDAIDRREDTFYVVSFRRD
HLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDTRVIHIKTS
TVPPSLRKQPSPTPGNATGGPLPVSAASQAHQASHQPLYLNHP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99941	1.000	1.000	0.000	703	1.000	1.000	Q99941.pdb.gz	ATF6B_HUMAN Cyclic AMP-dependent transcription factor ATF-6 beta OS=Homo sapiens OX=9606 GN=ATF6B PE=1 SV=2
2	AFDB:P18850	0.274	0.285	4.066E-33	670	0.337	0.354	P18850.pdb.gz	ATF6A_HUMAN Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Homo sapiens OX=9606 GN=ATF6 PE=1 SV=3
3	AFDB:F6VAN0	0.338	0.360	1.574E-31	656	0.333	0.357	F6VAN0.pdb.gz	ATF6A_MOUSE Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Mus musculus OX=10090 GN=Atf6 PE=1 SV=2
4	AFDB:Q4H3W1	0.097	0.107	2.181E-3	631	0.131	0.146	Q4H3W1.pdb.gz	Q4H3W1_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=Ci-ATF2/7 PE=1 SV=1
5	AFDB:Q9D666	0.063	0.049	2.181E-3	913	0.125	0.096	Q9D666.pdb.gz	SUN1_MOUSE SUN domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sun1 PE=1 SV=2
6	AFDB:Q9W539	0.074	0.039	3.504E-3	1518	0.161	0.074	Q9W539.pdb.gz	HR4_DROME Hormone receptor 4 OS=Drosophila melanogaster OX=7227 GN=Hr4 PE=1 SV=4
7	AFDB:Q8MRW5	0.055	0.060	7.379E-3	640	0.091	0.100	Q8MRW5.pdb.gz	ET96B_DROME ETV5-related protein Ets96B OS=Drosophila melanogaster OX=7227 GN=Ets96B PE=2 SV=1
8	AFDB:Q04980	0.055	0.060	7.896E-3	619	0.145	0.165	Q04980.pdb.gz	LTI65_ARATH Low-temperature-induced 65 kDa protein OS=Arabidopsis thaliana OX=3702 GN=LTI65 PE=2 SV=2
9	AFDB:Q550D5	0.071	0.058	9.041E-3	872	0.087	0.070	Q550D5.pdb.gz	GTAA_DICDI Transcription factor stalky OS=Dictyostelium discoideum OX=44689 GN=stkA PE=1 SV=1
10	AFDB:E9QHX3	0.082	0.053	1.108E-2	1246	0.124	0.070	E9QHX3.pdb.gz
11	PDB:7eu1M	0.046	0.032	2.549	1055	0.013	0.009	7eu1M.pdb.gz	Pol IV and RDR2: A two-RNA-polymerase machine that produces double-stranded RNA.
12	PDB:2zu0A	0.042	0.065	3.342	416	0.011	0.019	2zu0A.pdb.gz
13	PDB:6wcqC	0.027	0.087	3.827	130	0.010	0.054	6wcqC.pdb.gz
14	PDB:7eu0M	0.046	0.033	3.827	1052	0.016	0.010	7eu0M.pdb.gz	Pol IV and RDR2: A two-RNA-polymerase machine that produces double-stranded RNA.
15	PDB:5z62B	0.028	0.070	4.689	227	0.014	0.044	5z62B.pdb.gz	Structure of the intact 14-subunit human cytochrome c oxidase.
16	PDB:6agbC	0.057	0.156	5.369	175	0.020	0.080	6agbC.pdb.gz	Structural insight into precursor tRNA processing by yeast ribonuclease P.
17	PDB:7odr5	0.032	0.052	7.039	394	0.020	0.036	7odr5.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
18	PDB:4fjvA	0.041	0.095	8.060	231	0.013	0.039	4fjvA.pdb.gz	The human otubain2-ubiquitin structure provides insights into the cleavage specificity of poly-ubiquitin-linkages.
19	PDB:4imaD	0.028	0.042	8.060	460	0.006	0.009	4imaD.pdb.gz	Energetic Coupling between an Oxidizable Cysteine and the Phosphorylatable N-Terminus of Human Liver Pyruvate Kinase.
20	PDB:7d5tRQ	0.027	0.046	8.060	339	0.037	0.077	7d5tRQ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state F1)

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35451	0.0	1120	699	0.876	0.881	ATF6B_MOUSE Cyclic AMP-dependent transcription factor ATF-6 beta OS=Mus musculus OX=10090 GN=Atf6b PE=1 SV=1
2	Q96QL7	0.0	536	318	0.393	0.868	Q96QL7_HUMAN ATF6B protein OS=Homo sapiens OX=9606 GN=ATF6B PE=1 SV=1
3	Q99941	0.0	1408	703	1.000	1.000	ATF6B_HUMAN Cyclic AMP-dependent transcription factor ATF-6 beta OS=Homo sapiens OX=9606 GN=ATF6B PE=1 SV=2
4	P18850	3.75e-87	289	670	0.273	0.287	ATF6A_HUMAN Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Homo sapiens OX=9606 GN=ATF6 PE=1 SV=3
5	G3V909	5.40e-87	288	656	0.273	0.293	ATF6A_RAT Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Rattus norvegicus OX=10116 GN=Atf6 PE=2 SV=1
6	F6VAN0	3.80e-86	286	656	0.270	0.290	ATF6A_MOUSE Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Mus musculus OX=10090 GN=Atf6 PE=1 SV=2
7	Q5RH85	1.01e-67	236	653	0.252	0.271	Q5RH85_DANRE Activating transcription factor 6 OS=Danio rerio OX=7955 GN=fi12h10 PE=4 SV=2
8	Q20435	1.60e-10	66.6	589	0.135	0.161	ATF6H_CAEEL Transcription factor atf-6 homolog OS=Caenorhabditis elegans OX=6239 GN=atf-6 PE=1 SV=2
9	Q68CJ9	1.07e-09	63.5	461	0.051	0.078	CR3L3_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 3 OS=Homo sapiens OX=9606 GN=CREB3L3 PE=1 SV=2
10	Q8TEY5	3.19e-09	62.0	395	0.046	0.081	CR3L4_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 4 OS=Homo sapiens OX=9606 GN=CREB3L4 PE=1 SV=1
11	Q91XE9	4.76e-09	61.6	479	0.048	0.071	CR3L3_MOUSE Cyclic AMP-responsive element-binding protein 3-like protein 3 OS=Mus musculus OX=10090 GN=Creb3l3 PE=1 SV=1
12	Q9D2A5	3.36e-08	58.5	370	0.048	0.092	CR3L4_MOUSE Cyclic AMP-responsive element-binding protein 3-like protein 4 OS=Mus musculus OX=10090 GN=Creb3l4 PE=1 SV=1
13	O43889	1.71e-06	53.1	371	0.053	0.100	CREB3_HUMAN Cyclic AMP-responsive element-binding protein 3 OS=Homo sapiens OX=9606 GN=CREB3 PE=1 SV=2
14	Q84LG2	3.00e-06	52.4	389	0.041	0.075	BZP68_ARATH bZIP transcription factor 68 OS=Arabidopsis thaliana OX=3702 GN=BZIP68 PE=1 SV=1
15	Q9M7Q2	4.26e-06	52.0	431	0.050	0.081	AI5L7_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 7 OS=Arabidopsis thaliana OX=3702 GN=ABF4 PE=1 SV=1
16	Q61817	6.55e-06	51.6	404	0.050	0.087	CREB3_MOUSE Cyclic AMP-responsive element-binding protein 3 OS=Mus musculus OX=10090 GN=Creb3 PE=2 SV=2
17	P18846	9.33e-06	50.1	271	0.047	0.122	ATF1_HUMAN Cyclic AMP-dependent transcription factor ATF-1 OS=Homo sapiens OX=9606 GN=ATF1 PE=1 SV=2
18	F4JB53	1.17e-05	50.8	432	0.043	0.069	F4JB53_ARATH ABRE binding factor 4 OS=Arabidopsis thaliana OX=3702 GN=ABF4 PE=1 SV=1
19	F7FD47	1.18e-05	50.1	268	0.047	0.123	F7FD47_RAT Activating transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Atf1 PE=4 SV=1
20	Q96BA8	1.47e-05	50.4	519	0.038	0.052	CR3L1_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 1 OS=Homo sapiens OX=9606 GN=CREB3L1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	1.3e-05	36.5	bZIP transcription factor
2	PF07716 bZIP_2	0.011	27.1	Basic region leucine zipper
3	PF03131 bZIP_Maf	7.9	18.4	bZIP Maf transcription factor
4	PF08990 Docking	2.4e+02	12.8	Erythronolide synthase docking domain
5	PF14362 DUF4407	4.7	18.0	Domain of unknown function (DUF4407)
6	PF16559 GIT_CC	28	15.9	GIT coiled-coil Rho guanine nucleotide exchange factor
7	PF06156 YabA	90	15.1	Initiation control protein YabA
8	PF06005 ZapB	36	16.2	Cell division protein ZapB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364349

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387699	0.869	Cyclic AMP-responsive element-binding protein 1
2	9606.ENSP00000216037	0.868	X-box-binding protein 1
3	9606.ENSP00000448665	0.865	DNA damage-inducible transcript 3 protein
4	9606.ENSP00000479667	0.863	Ribosomal protein S6 kinase alpha-5
5	9606.ENSP00000336790	0.862	Cyclic AMP-dependent transcription factor ATF-4
6	9606.ENSP00000356919	0.860	Cyclic AMP-dependent transcription factor ATF-6 alpha
7	9606.ENSP00000333896	0.853	Ribosomal protein S6 kinase alpha-4
8	9606.ENSP00000078445	0.846	Cyclic AMP-responsive element-binding protein 3-like protein 3
9	9606.ENSP00000264110	0.846	Cyclic AMP-dependent transcription factor ATF-2
10	9606.ENSP00000329140	0.844	Cyclic AMP-responsive element-binding protein 3-like protein 2
11	9606.ENSP00000481956	0.843	Cyclic AMP-responsive element-binding protein 3-like protein 1
12	9606.ENSP00000342136	0.838	Cyclic AMP-responsive element-binding protein 3
13	9606.ENSP00000226760	0.837	Wolframin
14	9606.ENSP00000357596	0.830	Cyclic AMP-responsive element-binding protein 3-like protein 4
15	9606.ENSP00000350359	0.807	Cyclic AMP-responsive element-binding protein 5
16	9606.ENSP00000262053	0.800	Cyclic AMP-dependent transcription factor ATF-1
17	9606.ENSP00000307235	0.752	Eukaryotic translation initiation factor 2-alpha kinase 3
18	9606.ENSP00000381535	0.714	Serine/threonine kinase 32A
19	9606.ENSP00000282356	0.694	Calcium/calmodulin-dependent protein kinase type IV
20	9606.ENSP00000363817	0.691	Retinoic acid receptor RXR-beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.998	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0042802	0.524	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050896	0.997	response to stimulus
GO:0080090	0.996	regulation of primary metabolic process
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0051171	0.996	regulation of nitrogen compound metabolic process
GO:0031323	0.996	regulation of cellular metabolic process
GO:0048522	0.995	positive regulation of cellular process
GO:0051716	0.993	cellular response to stimulus
GO:0045944	0.993	positive regulation of transcription by RNA polymerase II
GO:0009966	0.980	regulation of signal transduction
GO:1905897	0.979	regulation of response to endoplasmic reticulum stress
GO:0034976	0.972	response to endoplasmic reticulum stress
GO:0048519	0.967	negative regulation of biological process
GO:0048523	0.963	negative regulation of cellular process
GO:0036003	0.952	positive regulation of transcription from RNA polymerase II promoter in response to stress
GO:0007165	0.929	signal transduction
GO:0042221	0.926	response to chemical
GO:0030968	0.921	endoplasmic reticulum unfolded protein response
GO:1900101	0.908	regulation of endoplasmic reticulum unfolded protein response
GO:0006984	0.888	ER-nucleus signaling pathway
GO:0048585	0.811	negative regulation of response to stimulus
GO:0010648	0.759	negative regulation of cell communication
GO:1903573	0.735	negative regulation of response to endoplasmic reticulum stress
GO:0023057	0.677	negative regulation of signaling
GO:0009968	0.476	negative regulation of signal transduction
GO:0071704	0.402	organic substance metabolic process
GO:0044238	0.362	primary metabolic process
GO:0044237	0.329	cellular metabolic process
GO:0006807	0.324	nitrogen compound metabolic process
GO:0043170	0.317	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.999	protein-containing complex
GO:0005789	0.995	endoplasmic reticulum membrane
GO:0005667	0.965	transcription regulator complex
GO:0070013	0.965	intracellular organelle lumen
GO:0005794	0.961	Golgi apparatus
GO:0090575	0.936	RNA polymerase II transcription regulator complex
GO:0031981	0.935	nuclear lumen
GO:0005654	0.934	nucleoplasm
GO:0032993	0.772	protein-DNA complex
GO:0005829	0.695	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]