StarFunc result for job id Q99942

User Input

>input (180 residues)
MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPE
RQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGF
HFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RCQ4	0.389	0.389	1.106E-27	180	1.000	1.000	A0A024RCQ4.pdb.gz	A0A024RCQ4_HUMAN E3 ubiquitin-protein ligase RNF OS=Homo sapiens OX=9606 GN=RNF5 PE=4 SV=1
2	AFDB:Q96GF1	0.368	0.346	1.247E-17	192	0.606	0.568	Q96GF1.pdb.gz	RN185_HUMAN E3 ubiquitin-protein ligase RNF185 OS=Homo sapiens OX=9606 GN=RNF185 PE=1 SV=1
3	AFDB:Q8IR26	0.459	0.308	7.832E-14	283	0.472	0.300	Q8IR26.pdb.gz	Q8IR26_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=sordd2 PE=2 SV=2
4	AFDB:Q09463	0.494	0.393	2.100E-13	235	0.483	0.370	Q09463.pdb.gz	RNF5_CAEEL E3 ubiquitin ligase rnf-5 OS=Caenorhabditis elegans OX=6239 GN=rnf-5 PE=1 SV=1
5	AFDB:O64824	0.459	0.371	1.837E-11	227	0.383	0.304	O64824.pdb.gz	O64824_ARATH E3 ubiquitin-protein ligase RMA OS=Arabidopsis thaliana OX=3702 GN=At2g23780 PE=1 SV=1
6	AFDB:Q8GUK7	0.399	0.300	2.907E-10	243	0.294	0.218	Q8GUK7.pdb.gz	RMA3_ARATH E3 ubiquitin-protein ligase RMA3 OS=Arabidopsis thaliana OX=3702 GN=RMA3 PE=1 SV=1
7	AFDB:O64425	0.463	0.347	9.496E-10	249	0.239	0.173	O64425.pdb.gz	RMA1_ARATH E3 ubiquitin-protein ligase RMA1 OS=Arabidopsis thaliana OX=3702 GN=RMA1 PE=1 SV=1
8	AFDB:Q6R567	0.373	0.270	1.503E-8	252	0.267	0.190	Q6R567.pdb.gz	RMA1_CAPAN E3 ubiquitin-protein ligase RMA1H1 OS=Capsicum annuum OX=4072 GN=RMA1H1 PE=1 SV=1
9	AFDB:H2L089	0.295	0.169	1.822E-4	330	0.150	0.082	H2L089.pdb.gz	H2L089_CAEEL RING-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=par-2 PE=4 SV=1
10	PDB:5dkaA	0.268	0.488	2.888E-4	96	0.100	0.188	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
11	AFDB:P97868	0.316	0.037	5.951E-4	1790	0.189	0.019	P97868.pdb.gz	RBBP6_MOUSE E3 ubiquitin-protein ligase RBBP6 OS=Mus musculus OX=10090 GN=Rbbp6 PE=1 SV=5
12	PDB:5l9uB	0.248	0.599	1.705E-3	71	0.089	0.225	5l9uB.pdb.gz
13	PDB:5a31B	0.259	0.531	1.821E-3	84	0.083	0.179	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
14	PDB:3jb9U	0.259	0.116	2.529E-3	430	0.100	0.042	3jb9U.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
15	PDB:5gm6a	0.234	0.335	3.290E-3	123	0.083	0.122	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
16	PDB:7jzvA	0.273	0.197	3.514E-3	253	0.100	0.071	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
17	PDB:8a3tU	0.249	0.379	3.753E-3	114	0.078	0.123	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
18	PDB:4r8pL	0.299	0.217	5.946E-3	254	0.094	0.067	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
19	PDB:4a0cF	0.239	0.502	1.594E-2	80	0.083	0.188	4a0cF.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
20	PDB:2c2lA	0.299	0.196	1.942E-2	281	0.067	0.043	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024RCQ4	5.42e-131	366	180	1.000	1.000	A0A024RCQ4_HUMAN E3 ubiquitin-protein ligase RNF OS=Homo sapiens OX=9606 GN=RNF5 PE=4 SV=1
2	Q99942	5.42e-131	366	180	1.000	1.000	RNF5_HUMAN E3 ubiquitin-protein ligase RNF5 OS=Homo sapiens OX=9606 GN=RNF5 PE=1 SV=1
3	O35445	1.21e-128	360	180	0.978	0.978	RNF5_MOUSE E3 ubiquitin-protein ligase RNF5 OS=Mus musculus OX=10090 GN=Rnf5 PE=1 SV=1
4	Q96GF1	7.25e-62	191	192	0.556	0.521	RN185_HUMAN E3 ubiquitin-protein ligase RNF185 OS=Homo sapiens OX=9606 GN=RNF185 PE=1 SV=1
5	Q9VXP1	6.63e-53	171	277	0.478	0.310	Q9VXP1_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=sordd1 PE=1 SV=1
6	Q8IR26	1.91e-51	168	283	0.478	0.304	Q8IR26_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=sordd2 PE=2 SV=2
7	Q09463	7.00e-39	134	235	0.417	0.319	RNF5_CAEEL E3 ubiquitin ligase rnf-5 OS=Caenorhabditis elegans OX=6239 GN=rnf-5 PE=1 SV=1
8	O64824	1.47e-29	110	227	0.272	0.216	O64824_ARATH E3 ubiquitin-protein ligase RMA OS=Arabidopsis thaliana OX=3702 GN=At2g23780 PE=1 SV=1
9	P93744	2.42e-23	97.4	425	0.239	0.101	P93744_ARATH E3 ubiquitin-protein ligase RMA OS=Arabidopsis thaliana OX=3702 GN=MUSE2 PE=1 SV=1
10	P93030	2.97e-23	93.2	193	0.306	0.285	RMA2_ARATH E3 ubiquitin-protein ligase RMA2 OS=Arabidopsis thaliana OX=3702 GN=RMA2 PE=1 SV=1
11	A0A384L3Q5	1.16e-22	95.5	436	0.228	0.094	A0A384L3Q5_ARATH E3 ubiquitin-protein ligase RMA OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g52590 PE=1 SV=1
12	Q8RXF2	1.16e-22	95.5	436	0.228	0.094	Q8RXF2_ARATH E3 ubiquitin-protein ligase RMA OS=Arabidopsis thaliana OX=3702 GN=MUSE1 PE=1 SV=1
13	Q8GUK7	6.71e-22	90.9	243	0.244	0.181	RMA3_ARATH E3 ubiquitin-protein ligase RMA3 OS=Arabidopsis thaliana OX=3702 GN=RMA3 PE=1 SV=1
14	O64425	1.97e-21	89.7	249	0.211	0.153	RMA1_ARATH E3 ubiquitin-protein ligase RMA1 OS=Arabidopsis thaliana OX=3702 GN=RMA1 PE=1 SV=1
15	Q6R567	1.32e-19	84.7	252	0.239	0.171	RMA1_CAPAN E3 ubiquitin-protein ligase RMA1H1 OS=Capsicum annuum OX=4072 GN=RMA1H1 PE=1 SV=1
16	Q6NLR3	2.61e-16	77.8	413	0.189	0.082	Q6NLR3_ARATH E3 ubiquitin-protein ligase RMA OS=Arabidopsis thaliana OX=3702 GN=At2g44410 PE=1 SV=1
17	Q582V4	1.37e-10	60.8	298	0.144	0.087	Q582V4_TRYB2 Peroxisome assembly protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48O8.510 PE=3 SV=1
18	Q9W0D7	5.56e-10	58.9	299	0.122	0.074	Q9W0D7_DROME GM14467p OS=Drosophila melanogaster OX=7227 GN=Pex10 PE=2 SV=1
19	Q9SYU4	5.47e-08	53.5	381	0.117	0.055	PEX10_ARATH Peroxisome biogenesis factor 10 OS=Arabidopsis thaliana OX=3702 GN=PEX10 PE=1 SV=1
20	O74563	5.90e-08	53.5	680	0.111	0.029	BRL2_SCHPO E3 ubiquitin-protein ligase brl2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=brl2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05290 Baculo_IE-1	39	15.6	Baculovirus immediate-early protein (IE-0)
2	PF14447 Prok-RING_4	0.0046	28.1	Prokaryotic RING finger family 4
3	PF04641 Rtf2	3e+02	12.2	Rtf2 RING-finger
4	PF12861 zf-ANAPC11	1.7	20.1	Anaphase-promoting complex subunit 11 RING-H2 finger
5	PF00097 zf-C3HC4	1.5e-05	36.0	Zinc finger, C3HC4 type (RING finger)
6	PF13923 zf-C3HC4_2	0.00024	32.1	Zinc finger, C3HC4 type (RING finger)
7	PF13920 zf-C3HC4_3	1.1e-06	39.7	Zinc finger, C3HC4 type (RING finger)
8	PF15227 zf-C3HC4_4	12	17.5	zinc finger of C3HC4-type, RING
9	PF11789 zf-Nse	2.5e+02	13.0	Zinc-finger of the MIZ type in Nse subunit
10	PF12678 zf-rbx1	0.13	23.8	RING-H2 zinc finger domain
11	PF17120 zf-RING_16	78	14.3	RING/Ubox like zinc-binding domain
12	PF13639 zf-RING_2	1.8e-05	36.3	Ring finger domain
13	PF14570 zf-RING_4	7.6e+02	11.3	RING/Ubox like zinc-binding domain
14	PF14634 zf-RING_5	0.00045	31.5	zinc-RING finger domain
15	PF13445 zf-RING_UBOX	0.00056	31.2	RING-type zinc-finger
16	PF14569 zf-UDP	1.1e+02	14.3	Zinc-binding RING-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000008029

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000005223	0.931	Ring finger protein 185
2	61853.ENSNLEP00000014239	0.903	Epithelial ion channel that plays an important role in the regulation of epithelial ion and water transport and fluid homeostasis. Mediates the transport of chloride ions across the cell membrane (By similarity). Channel activity is coupled to ATP hydrolysis. The ion channel is also permeable to HCO(3-)
3	61853.ENSNLEP00000006307	0.882	Derlin
4	61853.ENSNLEP00000024430	0.851	Peroxisome assembly protein 12
5	61853.ENSNLEP00000002337	0.830	Autocrine motility factor receptor, E3 ubiquitin protein ligase
6	61853.ENSNLEP00000011107	0.809	Derlin
7	61853.ENSNLEP00000007645	0.768	Ubiquitin-conjugating enzyme E2E 3
8	61853.ENSNLEP00000002410	0.761	Peroxisomal biogenesis factor 2
9	61853.ENSNLEP00000020484	0.755	SEL1L ERAD E3 ligase adaptor subunit
10	61853.ENSNLEP00000005742	0.750	Valosin containing protein
11	61853.ENSNLEP00000004290	0.740	Uncharacterized protein
12	61853.ENSNLEP00000015943	0.733	Ubiquitin-conjugating enzyme E2, J1
13	61853.ENSNLEP00000011626	0.699	Peroxisomal biogenesis factor 13
14	61853.ENSNLEP00000016480	0.696	Uncharacterized protein
15	61853.ENSNLEP00000010937	0.691	Endoplasmic reticulum lectin 1
16	61853.ENSNLEP00000011201	0.691	Autophagy-related protein 9
17	61853.ENSNLEP00000020945	0.676	Osteosarcoma amplified 9, endoplasmic reticulum lectin
18	61853.ENSNLEP00000017917	0.663	ER lipid raft associated 1
19	61853.ENSNLEP00000014769	0.645	ER lipid raft associated 2
20	61853.ENSNLEP00000009975	0.644	STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0061630	0.992	ubiquitin protein ligase activity
GO:0019899	0.487	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.988	response to stimulus
GO:0019538	0.986	protein metabolic process
GO:0016567	0.980	protein ubiquitination
GO:0044237	0.977	cellular metabolic process
GO:0050789	0.975	regulation of biological process
GO:0050794	0.971	regulation of cellular process
GO:0051716	0.937	cellular response to stimulus
GO:0010498	0.908	proteasomal protein catabolic process
GO:0035966	0.907	response to topologically incorrect protein
GO:0034976	0.906	response to endoplasmic reticulum stress
GO:0019941	0.899	modification-dependent protein catabolic process
GO:0019222	0.898	regulation of metabolic process
GO:0035967	0.889	cellular response to topologically incorrect protein
GO:0051788	0.872	response to misfolded protein
GO:0006511	0.853	ubiquitin-dependent protein catabolic process
GO:0071218	0.846	cellular response to misfolded protein
GO:0006515	0.843	protein quality control for misfolded or incompletely synthesized proteins
GO:0000209	0.803	protein polyubiquitination
GO:0051179	0.779	localization
GO:0036503	0.758	ERAD pathway
GO:0006517	0.756	protein deglycosylation
GO:0009894	0.747	regulation of catabolic process
GO:0031647	0.746	regulation of protein stability
GO:0051128	0.734	regulation of cellular component organization
GO:0043161	0.721	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0048519	0.715	negative regulation of biological process
GO:0033043	0.671	regulation of organelle organization
GO:0031323	0.652	regulation of cellular metabolic process
GO:0044087	0.646	regulation of cellular component biogenesis
GO:0044088	0.626	regulation of vacuole organization
GO:0044419	0.600	biological process involved in interspecies interaction between organisms
GO:0030433	0.577	ubiquitin-dependent ERAD pathway
GO:0048523	0.574	negative regulation of cellular process
GO:1902115	0.556	regulation of organelle assembly
GO:0051234	0.530	establishment of localization
GO:0006810	0.505	transport
GO:0048518	0.481	positive regulation of biological process
GO:0060255	0.472	regulation of macromolecule metabolic process
GO:0051171	0.452	regulation of nitrogen compound metabolic process
GO:0080090	0.451	regulation of primary metabolic process
GO:0048522	0.431	positive regulation of cellular process
GO:0009607	0.396	response to biotic stimulus
GO:0048583	0.372	regulation of response to stimulus
GO:0070936	0.365	protein K48-linked ubiquitination
GO:0009893	0.356	positive regulation of metabolic process
GO:0031648	0.325	protein destabilization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.999	membrane
GO:0012505	0.998	endomembrane system
GO:0005783	0.994	endoplasmic reticulum
GO:0031090	0.962	organelle membrane
GO:0005789	0.906	endoplasmic reticulum membrane
GO:0005829	0.415	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]