StarFunc result for job id Q99943

User Input

>input (283 residues)
MDLWPGAWMLLLLLFLLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAVLAIPVCAVRG
RNVENMKILRLMLLHIKYLYGIRVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVLPGR
CVPIAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGT
RNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTE
GLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPGGGG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35083	0.925	0.918	5.028E-51	285	0.912	0.905	O35083.pdb.gz	PLCA_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha OS=Mus musculus OX=10090 GN=Agpat1 PE=1 SV=1
2	AFDB:O15120	0.851	0.866	1.306E-34	278	0.463	0.471	O15120.pdb.gz	PLCB_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase beta OS=Homo sapiens OX=9606 GN=AGPAT2 PE=1 SV=1
3	AFDB:Q8K3K7	0.841	0.856	2.802E-33	278	0.435	0.442	Q8K3K7.pdb.gz	PLCB_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase beta OS=Mus musculus OX=10090 GN=Agpat2 PE=1 SV=1
4	AFDB:Q7KTI0	0.847	0.883	6.264E-26	271	0.286	0.299	Q7KTI0.pdb.gz	Q7KTI0_DROME 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Drosophila melanogaster OX=7227 GN=Agpat2 PE=2 SV=1
5	AFDB:Q9US20	0.840	0.852	3.874E-23	279	0.279	0.283	Q9US20.pdb.gz	YLD2_SCHPO Uncharacterized acyltransferase C1851.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1851.02 PE=3 SV=1
6	AFDB:P33333	0.784	0.734	1.188E-22	303	0.272	0.254	P33333.pdb.gz	PLSC_YEAST 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLC1 PE=1 SV=1
7	AFDB:Q5AEL8	0.785	0.760	1.332E-21	293	0.244	0.235	Q5AEL8.pdb.gz	Q5AEL8_CANAL 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SLC1 PE=3 SV=1
8	AFDB:P26647	0.748	0.859	4.875E-21	245	0.237	0.273	P26647.pdb.gz	PLSC_ECOLI 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=plsC PE=1 SV=1
9	AFDB:O53208	0.676	0.348	6.449E-16	580	0.216	0.105	O53208.pdb.gz	O53208_MYCTO Acyltransferase family protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2556 PE=3 SV=1
10	AFDB:Q9LLY4	0.681	0.570	7.697E-16	344	0.205	0.169	Q9LLY4.pdb.gz	LPAT1_BRANA 1-acyl-sn-glycerol-3-phosphate acyltransferase BAT2, chloroplastic OS=Brassica napus OX=3708 GN=BAT2 PE=1 SV=2
11	PDB:5f2tB	0.433	0.463	4.067E-5	262	0.127	0.137	5f2tB.pdb.gz	Structural basis for selective recognition of acyl chains by the membrane-associated acyltransferase PatA.
12	PDB:6ie0A	0.230	0.198	4.275E-2	347	0.102	0.084	6ie0A.pdb.gz	X-ray crystal structure of 2R,3R-butanediol dehydrogenase from Bacillus subtilis
13	PDB:4gkvB	0.215	0.188	1.236E-1	336	0.099	0.083	4gkvB.pdb.gz	Structure of Escherichia coli AdhP (ethanol-inducible dehydrogenase) with bound NAD.
14	PDB:4cvqA	0.166	0.137	1.867E-1	404	0.071	0.050	4cvqA.pdb.gz	Structural analysis and mutant growth properties reveal distinctive enzymatic and cellular roles for the three major L-alanine transaminases of Escherichia coli.
15	PDB:6xoiB	0.141	0.110	1.980E-1	403	0.060	0.042	6xoiB.pdb.gz	Discovery of TAK-981, a First-in-Class Inhibitor of SUMO-Activating Enzyme for the Treatment of Cancer.
16	PDB:4a2cA	0.222	0.192	2.101E-1	346	0.078	0.064	4a2cA.pdb.gz	The Crystal Structure of Galactitol-1-Phosphate 5-Dehydrogenase from Escherichia Coli K12 Provides Insights Into its Anomalous Behavior on Imac Processes
17	PDB:2f17A	0.207	0.221	2.992E-1	255	0.064	0.071	2f17A.pdb.gz	Pyrithiamine as a substrate for thiamine pyrophosphokinase
18	PDB:2zwaB	0.239	0.120	3.174E-1	683	0.078	0.032	2zwaB.pdb.gz	Structural basis of tRNA modification with CO2 fixation and methylation by wybutosine synthesizing enzyme TYW4.
19	PDB:6cwyD	0.113	0.077	3.174E-1	487	0.057	0.033	6cwyD.pdb.gz	Molecular mechanism of a covalent allosteric inhibitor of SUMO E1 activating enzyme.
20	PDB:6m1yA	0.233	0.089	3.174E-1	938	0.064	0.019	6m1yA.pdb.gz	Cryo-EM structures of the full-length human KCC2 and KCC3 cation-chloride cotransporters.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024RCV5	0.0	581	283	1.000	1.000	A0A024RCV5_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Homo sapiens OX=9606 PE=2 SV=1
2	O35083	0.0	512	285	0.915	0.909	PLCA_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha OS=Mus musculus OX=10090 GN=Agpat1 PE=1 SV=1
3	Q99943	0.0	581	283	1.000	1.000	PLCA_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha OS=Homo sapiens OX=9606 GN=AGPAT1 PE=1 SV=2
4	O15120	3.69e-81	248	278	0.428	0.435	PLCB_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase beta OS=Homo sapiens OX=9606 GN=AGPAT2 PE=1 SV=1
5	D4AC45	7.94e-76	234	265	0.392	0.419	D4AC45_RAT 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Rattus norvegicus OX=10116 GN=Agpat2 PE=1 SV=2
6	Q8K3K7	8.27e-76	234	278	0.410	0.417	PLCB_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase beta OS=Mus musculus OX=10090 GN=Agpat2 PE=1 SV=1
7	Q7KTI0	3.82e-42	147	271	0.290	0.303	Q7KTI0_DROME 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Drosophila melanogaster OX=7227 GN=Agpat2 PE=2 SV=1
8	Q8T9K7	4.64e-42	147	271	0.290	0.303	Q8T9K7_DROME 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Drosophila melanogaster OX=7227 GN=Agpat2 PE=2 SV=1
9	P33333	7.89e-40	142	303	0.272	0.254	PLSC_YEAST 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLC1 PE=1 SV=1
10	Q9US20	2.22e-36	132	279	0.244	0.247	YLD2_SCHPO Uncharacterized acyltransferase C1851.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1851.02 PE=3 SV=1
11	Q5AEL8	4.02e-31	119	293	0.226	0.218	Q5AEL8_CANAL 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SLC1 PE=3 SV=1
12	P26647	1.65e-29	114	245	0.233	0.269	PLSC_ECOLI 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=plsC PE=1 SV=1
13	Q9I7C1	4.25e-18	83.6	257	0.254	0.280	PLSC_PSEAE 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=lptA PE=3 SV=1
14	O53208	6.50e-15	76.6	580	0.180	0.088	O53208_MYCTO Acyltransferase family protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2556 PE=3 SV=1
15	Q9LLY4	2.13e-12	68.6	344	0.148	0.122	LPAT1_BRANA 1-acyl-sn-glycerol-3-phosphate acyltransferase BAT2, chloroplastic OS=Brassica napus OX=3708 GN=BAT2 PE=1 SV=2
16	Q8GXU8	9.56e-11	63.9	356	0.145	0.115	LPAT1_ARATH 1-acyl-sn-glycerol-3-phosphate acyltransferase LPAT1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LPAT1 PE=1 SV=1
17	O53516	2.00e-09	58.9	247	0.198	0.227	O53516_MYCTU 1-acylglycerol-3-phosphate O-acyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2182c PE=1 SV=1
18	P74498	5.41e-07	51.6	225	0.159	0.200	P74498_SYNY3 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1848 PE=3 SV=1
19	Q8GWG0	1.31e-05	48.1	376	0.233	0.176	GPAT9_ARATH Glycerol-3-phosphate acyltransferase 9 OS=Arabidopsis thaliana OX=3702 GN=GPAT9 PE=1 SV=1
20	O07807	1.55e-05	47.8	259	0.159	0.174	O07807_MYCTU Possible acyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3816c PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01553 Acyltransferase	3.9e-30	115.7	Acyltransferase
2	PF10913 DUF2706	8.7e+02	11.2	Protein of unknown function (DUF2706)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005553476.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005556960.1	0.997	Phospholipid phosphatase 1
2	9541.XP_005543309.1	0.996	Uncharacterized protein
3	9541.XP_005587366.1	0.996	Phospholipid phosphatase 2
4	9541.XP_005566481.1	0.992	Glycerol-3-phosphate acyltransferase 1, mitochondrial isoform X1
5	9541.XP_005554949.1	0.990	Phosphatidate cytidylyltransferase 1
6	9541.XP_005568459.1	0.990	Phosphatidate cytidylyltransferase 2 isoform X1
7	9541.XP_005554951.1	0.980	Glycerol-3-phosphate acyltransferase 3 isoform X1
8	9541.XP_005563225.1	0.975	Glycerol-3-phosphate acyltransferase 4 isoform X1
9	9541.XP_005542679.1	0.966	Lipid phosphate phosphatase-related protein type 4-like isoform X2
10	9541.XP_005588087.1	0.966	Uncharacterized protein
11	9541.XP_005588676.1	0.966	Lipid phosphate phosphatase-related protein type 3-like
12	9541.XP_005575031.1	0.965	Glycerol-3-phosphate acyltransferase 2, mitochondrial-like
13	9541.XP_005563144.1	0.956	Uncharacterized protein
14	9541.XP_005566644.1	0.946	Uncharacterized protein
15	9541.XP_005553995.1	0.943	Lysophospholipid acyltransferase 1
16	9541.XP_005576658.1	0.943	Uncharacterized protein
17	9541.XP_005539840.1	0.928	Dihydroxyacetone phosphate acyltransferase isoform X1
18	9541.XP_005548628.1	0.919	1-acylglycerol-3-phosphate O-acyltransferase 3
19	9541.XP_005562580.1	0.916	1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon isoform X1
20	9541.XP_005551552.1	0.913	Converts 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone (By similarity). Exhibits high acyl-CoA specificity for polyunsaturated fatty acyl-CoA, especially docosahexaenoyl-CoA (22:6-CoA, DHA-CoA) (By similarity)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003841	1.000	1-acylglycerol-3-phosphate O-acyltransferase activity
GO:0005515	0.932	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0044255	0.987	cellular lipid metabolic process
GO:0045017	0.978	glycerolipid biosynthetic process
GO:0006650	0.973	glycerophospholipid metabolic process
GO:0090407	0.968	organophosphate biosynthetic process
GO:0046473	0.959	phosphatidic acid metabolic process
GO:0046474	0.956	glycerophospholipid biosynthetic process
GO:0006654	0.937	phosphatidic acid biosynthetic process
GO:0065007	0.600	biological regulation
GO:0050789	0.590	regulation of biological process
GO:0050794	0.578	regulation of cellular process
GO:0048518	0.346	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0031090	0.996	organelle membrane
GO:0005789	0.983	endoplasmic reticulum membrane
GO:0071944	0.673	cell periphery
GO:0005886	0.495	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19709	1.000	a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA
EC:2.3.1.51	1.000	1-acylglycerol-3-phosphate O-acyltransferase.

[back to server]