StarFunc result for job id Q99958

User Input

>input (501 residues)
MQARYSVSDPNALGVVPYLSEQNYYRAAGSYGGMASPMGVYSGHPEQYSAGMGRSYAPYH
HHQPAAPKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSI
RHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVSKEKEER
AHLKEPPPAASKGAPATPHLADAPKEAEKKVVIKSEAASPALPVITKVETLSPESALQGS
PRSAASTPAGSPDGSLPEHHAAAPNGLPGFSVENIMTLRTSPPGGELSPGAGRAGLVVPP
LALPYAAAPPAAYGQPCAQGLEAGAAGGYQCSMRAMSLYTGAERPAHMCVPPALDEALSD
HPSGPTSPLSALNLAAGQEGALAATGHHHQHHGHHHPQAPPPPPAPQPQPTPQPGAAAAQ
AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLP
YRSTPPLYRHAAPYSYDCTKY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99958	0.999	0.999	3.196E-74	501	1.000	1.000	Q99958.pdb.gz	FOXC2_HUMAN Forkhead box protein C2 OS=Homo sapiens OX=9606 GN=FOXC2 PE=1 SV=1
2	AFDB:Q9DE25	0.268	0.279	5.659E-38	476	0.523	0.550	Q9DE25.pdb.gz	FXC1A_DANRE Forkhead box C1-A OS=Danio rerio OX=7955 GN=foxc1a PE=2 SV=1
3	AFDB:Q64731	0.204	0.299	1.835E-19	336	0.253	0.378	Q64731.pdb.gz	FOXL1_MOUSE Forkhead box protein L1 OS=Mus musculus OX=10090 GN=Foxl1 PE=2 SV=2
4	AFDB:E7EZ33	0.210	0.300	6.979E-19	348	0.232	0.333	E7EZ33.pdb.gz
5	AFDB:Q07342	0.208	0.254	1.405E-18	409	0.224	0.274	Q07342.pdb.gz	FOXA2_DANRE Forkhead box protein A2 OS=Danio rerio OX=7955 GN=foxa2 PE=2 SV=1
6	AFDB:Q9QY14	0.215	0.367	5.695E-18	288	0.224	0.389	Q9QY14.pdb.gz	FOXE3_MOUSE Forkhead box protein E3 OS=Mus musculus OX=10090 GN=Foxe3 PE=1 SV=1
7	AFDB:Q61574	0.220	0.331	8.890E-18	329	0.242	0.368	Q61574.pdb.gz	FOXS1_MOUSE Forkhead box protein S1 OS=Mus musculus OX=10090 GN=Foxs1 PE=2 SV=2
8	AFDB:O73843	0.246	0.374	9.474E-18	324	0.206	0.318	O73843.pdb.gz	O73843_SALSA Fork head domain protein OS=Salmo salar OX=8030 GN=fkh PE=2 SV=1
9	AFDB:Q16676	0.228	0.244	2.166E-17	465	0.253	0.273	Q16676.pdb.gz	FOXD1_HUMAN Forkhead box protein D1 OS=Homo sapiens OX=9606 GN=FOXD1 PE=1 SV=1
10	AFDB:Q12952	0.200	0.288	2.794E-17	345	0.253	0.368	Q12952.pdb.gz	FOXL1_HUMAN Forkhead box protein L1 OS=Homo sapiens OX=9606 GN=FOXL1 PE=2 SV=2
11	PDB:2hdcA	0.166	0.676	5.370E-10	97	0.140	0.722	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
12	PDB:7k5yU	0.123	0.611	5.886E-2	75	0.028	0.187	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
13	PDB:2nyxB	0.084	0.240	1.736E-1	147	0.016	0.054	2nyxB.pdb.gz
14	PDB:4etsB	0.117	0.347	2.887E-1	149	0.018	0.060	4etsB.pdb.gz	Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.
15	PDB:2qbyB	0.118	0.155	3.077E-1	368	0.020	0.027	2qbyB.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
16	PDB:6i6mB	0.117	0.155	3.495E-1	357	0.024	0.034	6i6mB.pdb.gz	Structure of Papaver somniferum O-Methyltransferase 1 Reveals Initiation of Noscapine Biosynthesis with Implications for Plant Natural Product Methylation
17	PDB:2qbyA	0.107	0.140	3.724E-1	366	0.022	0.030	2qbyA.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
18	PDB:6iwtA	0.128	0.176	4.507E-1	346	0.022	0.032	6iwtA.pdb.gz
19	PDB:3euhC	0.121	0.260	4.803E-1	206	0.026	0.063	3euhC.pdb.gz
20	PDB:3euhB	0.145	0.214	5.455E-1	321	0.022	0.034	3euhB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q61850	0.0	801	494	0.880	0.893	FOXC2_MOUSE Forkhead box protein C2 OS=Mus musculus OX=10090 GN=Foxc2 PE=1 SV=2
2	Q63246	0.0	809	494	0.884	0.897	FOXC2_RAT Forkhead box protein C2 OS=Rattus norvegicus OX=10116 GN=Foxc2 PE=1 SV=2
3	Q99958	0.0	1021	501	1.000	1.000	FOXC2_HUMAN Forkhead box protein C2 OS=Homo sapiens OX=9606 GN=FOXC2 PE=1 SV=1
4	Q9PVY9	0.0	608	465	0.655	0.705	FXC2A_XENLA Forkhead box protein C2-A OS=Xenopus laevis OX=8355 GN=foxc2-a PE=2 SV=1
5	Q9DE25	4.46e-140	413	476	0.513	0.540	FXC1A_DANRE Forkhead box C1-A OS=Danio rerio OX=7955 GN=foxc1a PE=2 SV=1
6	Q9PVZ3	4.35e-123	370	492	0.507	0.516	FXC1A_XENLA Forkhead box protein C1-A OS=Xenopus laevis OX=8355 GN=foxc1-a PE=2 SV=1
7	Q9DE24	8.25e-116	350	433	0.465	0.538	FXC1B_DANRE Forkhead box C1-B OS=Danio rerio OX=7955 GN=foxc1b PE=2 SV=1
8	Q61572	3.29e-92	293	553	0.323	0.293	FOXC1_MOUSE Forkhead box protein C1 OS=Mus musculus OX=10090 GN=Foxc1 PE=1 SV=3
9	Q12948	3.27e-90	288	553	0.309	0.280	FOXC1_HUMAN Forkhead box protein C1 OS=Homo sapiens OX=9606 GN=FOXC1 PE=1 SV=3
10	W6CJ52	3.27e-90	288	553	0.309	0.280	W6CJ52_HUMAN Forkhead box C1 OS=Homo sapiens OX=9606 GN=FOXC1 PE=4 SV=1
11	P32027	6.39e-64	218	508	0.244	0.240	CROC_DROME Fork head domain-containing protein crocodile OS=Drosophila melanogaster OX=7227 GN=croc PE=2 SV=2
12	Q64731	1.57e-54	188	336	0.224	0.333	FOXL1_MOUSE Forkhead box protein L1 OS=Mus musculus OX=10090 GN=Foxl1 PE=2 SV=2
13	Q7SY22	9.08e-50	176	363	0.146	0.201	Q7SY22_DANRE Forkhead box L1 OS=Danio rerio OX=7955 GN=zgc:63595 PE=2 SV=1
14	Q12952	1.08e-49	175	345	0.150	0.217	FOXL1_HUMAN Forkhead box protein L1 OS=Homo sapiens OX=9606 GN=FOXL1 PE=2 SV=2
15	Q61574	2.28e-48	171	329	0.202	0.307	FOXS1_MOUSE Forkhead box protein S1 OS=Mus musculus OX=10090 GN=Foxs1 PE=2 SV=2
16	P35583	6.30e-48	174	459	0.160	0.174	FOXA2_MOUSE Hepatocyte nuclear factor 3-beta OS=Mus musculus OX=10090 GN=Foxa2 PE=1 SV=2
17	P14734	1.44e-47	174	510	0.152	0.149	FKH_DROME Protein fork head OS=Drosophila melanogaster OX=7227 GN=fkh PE=1 SV=1
18	O43638	2.06e-47	169	330	0.170	0.258	FOXS1_HUMAN Forkhead box protein S1 OS=Homo sapiens OX=9606 GN=FOXS1 PE=2 SV=2
19	Q07342	4.54e-47	170	409	0.216	0.264	FOXA2_DANRE Forkhead box protein A2 OS=Danio rerio OX=7955 GN=foxa2 PE=2 SV=1
20	P33205	9.11e-47	169	399	0.162	0.203	FXA4A_XENLA Forkhead box protein A4-A OS=Xenopus laevis OX=8355 GN=foxa4-a PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	1.7e-36	135.5	Forkhead domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000326371

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000389377	0.952	Nuclear factor of activated T-cells, cytoplasmic 1
2	9606.ENSP00000384524	0.913	ETS translocation variant 2
3	9606.ENSP00000380034	0.762	Zinc finger protein SNAI2
4	9606.ENSP00000325074	0.753	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
5	9606.ENSP00000242261	0.746	Twist-related protein 1
6	9606.ENSP00000244050	0.730	Zinc finger protein SNAI1
7	9606.ENSP00000354487	0.718	Zinc finger E-box-binding homeobox 1
8	9606.ENSP00000341815	0.704	Transcription factor SOX-18
9	9606.ENSP00000454157	0.694	Zinc finger E-box-binding homeobox 2
10	9606.ENSP00000482581	0.690	Twist-related protein 2
11	9606.ENSP00000261937	0.682	Vascular endothelial growth factor receptor 3
12	9606.ENSP00000402608	0.666	Carbamoyl-phosphate synthase [ammonia], mitochondrial
13	9606.ENSP00000246080	0.660	Transcription factor 15
14	9606.ENSP00000300057	0.660	Mesoderm posterior protein 1
15	9606.ENSP00000261769	0.644	Cadherin-1
16	9606.ENSP00000480043	0.644	Vascular endothelial growth factor C
17	9606.ENSP00000355925	0.641	Prospero homeobox protein 1
18	9606.ENSP00000256178	0.638	Lymphatic vessel endothelial hyaluronic acid receptor 1
19	9606.ENSP00000344456	0.635	Catenin beta-1
20	9606.ENSP00000269141	0.630	Cadherin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005515	0.999	protein binding
GO:0000977	0.999	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001216	0.997	DNA-binding transcription activator activity
GO:0003682	0.991	chromatin binding
GO:0000987	0.984	cis-regulatory region sequence-specific DNA binding
GO:0001228	0.955	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.943	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0042802	0.929	identical protein binding
GO:0031490	0.878	chromatin DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0032501	0.996	multicellular organismal process
GO:0048856	0.996	anatomical structure development
GO:0007275	0.988	multicellular organism development
GO:0009987	0.987	cellular process
GO:0010556	0.986	regulation of macromolecule biosynthetic process
GO:0031326	0.986	regulation of cellular biosynthetic process
GO:0051252	0.985	regulation of RNA metabolic process
GO:0048518	0.983	positive regulation of biological process
GO:0006355	0.981	regulation of DNA-templated transcription
GO:0048731	0.950	system development
GO:0050896	0.945	response to stimulus
GO:0048519	0.930	negative regulation of biological process
GO:0009653	0.888	anatomical structure morphogenesis
GO:0006357	0.869	regulation of transcription by RNA polymerase II
GO:0048522	0.868	positive regulation of cellular process
GO:0048513	0.862	animal organ development
GO:0010604	0.852	positive regulation of macromolecule metabolic process
GO:0051173	0.840	positive regulation of nitrogen compound metabolic process
GO:0031325	0.838	positive regulation of cellular metabolic process
GO:0051716	0.832	cellular response to stimulus
GO:0048523	0.793	negative regulation of cellular process
GO:0010557	0.747	positive regulation of macromolecule biosynthetic process
GO:0031328	0.716	positive regulation of cellular biosynthetic process
GO:0045935	0.715	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.706	positive regulation of RNA metabolic process
GO:0009892	0.699	negative regulation of metabolic process
GO:0007154	0.698	cell communication
GO:0045893	0.696	positive regulation of DNA-templated transcription
GO:0051239	0.685	regulation of multicellular organismal process
GO:0072359	0.684	circulatory system development
GO:0007165	0.681	signal transduction
GO:0045944	0.673	positive regulation of transcription by RNA polymerase II
GO:0007166	0.625	cell surface receptor signaling pathway
GO:0001944	0.619	vasculature development
GO:0009888	0.551	tissue development
GO:0009719	0.513	response to endogenous stimulus
GO:0040012	0.489	regulation of locomotion
GO:0030334	0.465	regulation of cell migration
GO:0042221	0.455	response to chemical
GO:0050793	0.455	regulation of developmental process
GO:0010605	0.439	negative regulation of macromolecule metabolic process
GO:0051172	0.422	negative regulation of nitrogen compound metabolic process
GO:0031324	0.422	negative regulation of cellular metabolic process
GO:0048869	0.421	cellular developmental process
GO:0009890	0.406	negative regulation of biosynthetic process
GO:0045934	0.400	negative regulation of nucleobase-containing compound metabolic process
GO:0030154	0.396	cell differentiation
GO:0031327	0.388	negative regulation of cellular biosynthetic process
GO:0010558	0.382	negative regulation of macromolecule biosynthetic process
GO:0048646	0.381	anatomical structure formation involved in morphogenesis
GO:0071495	0.370	cellular response to endogenous stimulus
GO:0001945	0.353	lymph vessel development
GO:0070887	0.347	cellular response to chemical stimulus
GO:0045892	0.341	negative regulation of DNA-templated transcription
GO:0030335	0.334	positive regulation of cell migration
GO:0048583	0.310	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.995	intracellular organelle lumen
GO:0031981	0.992	nuclear lumen
GO:0005654	0.984	nucleoplasm
GO:0005737	0.636	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]