StarFunc result for job id Q99966

User Input

>input (193 residues)
MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGA
PTSSSGSPIGSPTTTPPTKPPSFNLHPAPHLLASMHLQKLNSQYQGMAAATPGQPGEAGP
LQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQ
NEFDFTADFPSSC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99966	0.999	0.999	6.011E-30	193	1.000	1.000	Q99966.pdb.gz	CITE1_HUMAN Cbp/p300-interacting transactivator 1 OS=Homo sapiens OX=9606 GN=CITED1 PE=1 SV=2
2	AFDB:Q4V8P1	0.223	0.213	1.313E-20	203	0.808	0.768	Q4V8P1.pdb.gz	Q4V8P1_RAT Cbp/p300-interacting transactivator with Glu/Asp-rich carboxy-terminal domain 1 OS=Rattus norvegicus OX=10116 GN=Cited1 PE=3 SV=1
3	AFDB:Q9I8K7	0.194	0.184	1.723E-7	205	0.332	0.312	Q9I8K7.pdb.gz	CITE3_CHICK Cbp/p300-interacting transactivator 3 OS=Gallus gallus OX=9031 GN=CITED3 PE=2 SV=1
4	AFDB:Q96RK1	0.257	0.267	4.605E-5	184	0.301	0.315	Q96RK1.pdb.gz	CITE4_HUMAN Cbp/p300-interacting transactivator 4 OS=Homo sapiens OX=9606 GN=CITED4 PE=1 SV=1
5	AFDB:Q94CL9	0.117	0.116	7.502E-3	195	0.135	0.133	Q94CL9.pdb.gz	KRP7_ARATH Cyclin-dependent kinase inhibitor 7 OS=Arabidopsis thaliana OX=3702 GN=KRP7 PE=1 SV=2
6	AFDB:O14267	0.109	0.039	6.722E-2	759	0.119	0.030	O14267.pdb.gz	YFPC_SCHPO Uncharacterized protein C7D4.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC7D4.12c PE=3 SV=1
7	AFDB:P14164	0.138	0.044	7.215E-2	731	0.140	0.037	P14164.pdb.gz	ABF1_YEAST ARS-binding factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ABF1 PE=1 SV=4
8	AFDB:F4HZ25	0.124	0.047	8.921E-2	668	0.124	0.036	F4HZ25.pdb.gz	F4HZ25_ARATH Sec14p-like phosphatidylinositol transfer family protein OS=Arabidopsis thaliana OX=3702 GN=At1g75370 PE=1 SV=1
9	AFDB:Q99MY0	0.154	0.086	9.575E-2	378	0.130	0.066	Q99MY0.pdb.gz	SPZ1_MOUSE Spermatogenic leucine zipper protein 1 OS=Mus musculus OX=10090 GN=Spz1 PE=1 SV=1
10	AFDB:F4IUY1	0.119	0.038	1.364E-1	837	0.140	0.032	F4IUY1.pdb.gz	F4IUY1_ARATH CAP-gly domain linker OS=Arabidopsis thaliana OX=3702 GN=At2g39300 PE=1 SV=1
11	PDB:5u6yA	0.097	0.052	4.299	459	0.062	0.026	5u6yA.pdb.gz
12	PDB:6v8oE	0.104	0.143	6.123	120	0.098	0.158	6v8oE.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
13	PDB:6gawAp	0.089	0.090	6.571	190	0.104	0.105	6gawAp.pdb.gz	Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM.
14	PDB:6rqlA	0.087	0.018	6.571	1542	0.098	0.012	6rqlA.pdb.gz	Molecular insight into RNA polymerase I promoter recognition and promoter melting.
15	PDB:6hivAU	0.111	0.120	8.720	175	0.088	0.097	6hivAU.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99966	4.35e-140	390	193	1.000	1.000	CITE1_HUMAN Cbp/p300-interacting transactivator 1 OS=Homo sapiens OX=9606 GN=CITED1 PE=1 SV=2
2	Q4V8P1	1.34e-92	270	203	0.788	0.749	Q4V8P1_RAT Cbp/p300-interacting transactivator with Glu/Asp-rich carboxy-terminal domain 1 OS=Rattus norvegicus OX=10116 GN=Cited1 PE=3 SV=1
3	P97769	1.88e-89	262	203	0.762	0.724	CITE1_MOUSE Cbp/p300-interacting transactivator 1 OS=Mus musculus OX=10090 GN=Cited1 PE=1 SV=1
4	Q9I8K7	2.53e-24	96.7	205	0.290	0.273	CITE3_CHICK Cbp/p300-interacting transactivator 3 OS=Gallus gallus OX=9031 GN=CITED3 PE=2 SV=1
5	A8E5L7	1.60e-21	90.5	254	0.275	0.209	A8E5L7_DANRE Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 4b OS=Danio rerio OX=7955 GN=cited3 PE=2 SV=1
6	O35740	9.65e-19	83.2	269	0.176	0.126	CITE2_MOUSE Cbp/p300-interacting transactivator 2 OS=Mus musculus OX=10090 GN=Cited2 PE=1 SV=2
7	Q99MA1	9.85e-19	83.2	269	0.176	0.126	Q99MA1_RAT Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 2 OS=Rattus norvegicus OX=10116 GN=Cited2 PE=2 SV=1
8	Q99967	1.00e-18	83.2	270	0.176	0.126	CITE2_HUMAN Cbp/p300-interacting transactivator 2 OS=Homo sapiens OX=9606 GN=CITED2 PE=1 SV=2
9	Q9WUL8	2.68e-09	56.2	182	0.130	0.137	CITE4_MOUSE Cbp/p300-interacting transactivator 4 OS=Mus musculus OX=10090 GN=Cited4 PE=1 SV=1
10	Q96RK1	3.92e-09	55.8	184	0.130	0.136	CITE4_HUMAN Cbp/p300-interacting transactivator 4 OS=Homo sapiens OX=9606 GN=CITED4 PE=1 SV=1
11	Q52PJ5	2.3	31.2	567	0.124	0.042	DPYL3_DANRE Dihydropyrimidinase-related protein 3 OS=Danio rerio OX=7955 GN=dpysl3 PE=2 SV=1
12	A5WWA0	4.7	30.4	868	0.114	0.025	ZNRF3_DANRE E3 ubiquitin-protein ligase znrf3 OS=Danio rerio OX=7955 GN=znrf3 PE=1 SV=2
13	P51839	5.4	30.4	1110	0.114	0.020	GUC2D_RAT Guanylate cyclase 2D OS=Rattus norvegicus OX=10116 GN=Gucy2d PE=1 SV=2
14	A2R2V4	9.9	29.3	480	0.098	0.040	OTASE_ASPNC Ochratoxinase OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=Am2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04487 CITED	5.3e-28	110.1	CITED

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000401764

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263253	0.988	Histone acetyltransferase p300
2	9606.ENSP00000341551	0.982	Mothers against decapentaplegic homolog 4
3	9606.ENSP00000432083	0.956	Heat shock cognate 71 kDa protein
4	9606.ENSP00000262367	0.940	CREB-binding protein
5	9606.ENSP00000262160	0.924	Mothers against decapentaplegic homolog 2
6	9606.ENSP00000332973	0.901	Mothers against decapentaplegic homolog 3
7	9606.ENSP00000291527	0.900	Trefoil factor 1
8	9606.ENSP00000295400	0.900	Protransforming growth factor alpha
9	9606.ENSP00000377265	0.891	Transcription factor AP-2-beta
10	9606.ENSP00000201031	0.797	Transcription factor AP-2 gamma
11	9606.ENSP00000219746	0.788	TOX high mobility group box family member 3
12	9606.ENSP00000405330	0.721	Estrogen receptor
13	9606.ENSP00000304502	0.713	Homeobox protein SIX2
14	9606.ENSP00000444198	0.696	Cbp/p300-interacting transactivator 2
15	9606.ENSP00000368924	0.666	Transcription factor AP-2-alpha
16	9606.ENSP00000362332	0.658	Transcription factor AP-2-epsilon
17	9606.ENSP00000272342	0.644	Ewing's tumor-associated antigen 1
18	9606.ENSP00000368632	0.642	Trans-acting T-cell-specific transcription factor GATA-3
19	9606.ENSP00000381098	0.642	Glutamate receptor-interacting protein 1
20	9606.ENSP00000008391	0.629	Transcription factor AP-2-delta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003713	1.000	transcription coactivator activity
GO:0046983	0.996	protein dimerization activity
GO:0046332	0.995	SMAD binding
GO:0019904	0.995	protein domain specific binding
GO:0042803	0.989	protein homodimerization activity
GO:0050693	0.942	LBD domain binding
GO:0070410	0.928	co-SMAD binding
GO:0008134	0.303	transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0051171	0.997	regulation of nitrogen compound metabolic process
GO:0032502	0.986	developmental process
GO:0048518	0.985	positive regulation of biological process
GO:0009987	0.983	cellular process
GO:0048856	0.981	anatomical structure development
GO:0060255	0.979	regulation of macromolecule metabolic process
GO:0080090	0.978	regulation of primary metabolic process
GO:0009889	0.977	regulation of biosynthetic process
GO:0031323	0.977	regulation of cellular metabolic process
GO:0048513	0.972	animal organ development
GO:0006355	0.970	regulation of DNA-templated transcription
GO:0048523	0.968	negative regulation of cellular process
GO:0032501	0.966	multicellular organismal process
GO:0010604	0.966	positive regulation of macromolecule metabolic process
GO:0045935	0.965	positive regulation of nucleobase-containing compound metabolic process
GO:0009891	0.964	positive regulation of biosynthetic process
GO:0050896	0.962	response to stimulus
GO:0007275	0.955	multicellular organism development
GO:0010557	0.935	positive regulation of macromolecule biosynthetic process
GO:0048731	0.930	system development
GO:0045893	0.926	positive regulation of DNA-templated transcription
GO:0010605	0.907	negative regulation of macromolecule metabolic process
GO:0051253	0.895	negative regulation of RNA metabolic process
GO:0009719	0.892	response to endogenous stimulus
GO:0045892	0.882	negative regulation of DNA-templated transcription
GO:0006357	0.855	regulation of transcription by RNA polymerase II
GO:0051716	0.842	cellular response to stimulus
GO:0042221	0.839	response to chemical
GO:0045944	0.800	positive regulation of transcription by RNA polymerase II
GO:0048583	0.716	regulation of response to stimulus
GO:0010646	0.705	regulation of cell communication
GO:0023051	0.704	regulation of signaling
GO:0010033	0.700	response to organic substance
GO:0009966	0.692	regulation of signal transduction
GO:0007154	0.684	cell communication
GO:0023052	0.665	signaling
GO:0030154	0.652	cell differentiation
GO:0007165	0.618	signal transduction
GO:0048584	0.523	positive regulation of response to stimulus
GO:0007166	0.507	cell surface receptor signaling pathway
GO:0009888	0.495	tissue development
GO:0071495	0.463	cellular response to endogenous stimulus
GO:0009967	0.455	positive regulation of signal transduction
GO:0042127	0.411	regulation of cell population proliferation
GO:0008152	0.389	metabolic process
GO:0071704	0.364	organic substance metabolic process
GO:0009725	0.358	response to hormone
GO:0001822	0.323	kidney development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005654	0.998	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]