StarFunc result for job id Q99967

User Input

>input (270 residues)
MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGEHIHYGA
GNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLN
NQYFNHHPYPHNHYMPDLHPAAGHQMNGTNQHFRDCNPKHSGGSSTPGGSGGSSTPGGSG
SSSGGGAGSSNSGGGSGSGNMPASVAHVPAAMLPPNVIDTDFIDEEVLMSLVIEMGLDRI
KELPELWLGQNEFDFMTDFVCKQQPSRVSC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99967	0.999	0.999	6.736E-43	270	1.000	1.000	Q99967.pdb.gz	CITE2_HUMAN Cbp/p300-interacting transactivator 2 OS=Homo sapiens OX=9606 GN=CITED2 PE=1 SV=2
2	AFDB:P54637	0.073	0.030	1.947E-1	990	0.219	0.060	P54637.pdb.gz	PTP3_DICDI Tyrosine-protein phosphatase 3 OS=Dictyostelium discoideum OX=44689 GN=ptpC PE=2 SV=2
3	AFDB:Q9U9A9	0.095	0.032	3.428E-1	1100	0.156	0.038	Q9U9A9.pdb.gz	Q9U9A9_DROME Tuberous sclerosis gene product-1 homolog OS=Drosophila melanogaster OX=7227 GN=Tsc1 PE=2 SV=1
4	AFDB:Q9NH72	0.071	0.036	6.036E-1	690	0.156	0.061	Q9NH72.pdb.gz	Q9NH72_DROME Rasputin OS=Drosophila melanogaster OX=7227 GN=rin PE=2 SV=1
5	AFDB:Q57WH0	0.088	0.023	9.902E-1	1241	0.156	0.034	Q57WH0.pdb.gz	Q57WH0_TRYB2 C2 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.500 PE=4 SV=1
6	AFDB:Q96DT7	0.105	0.041	1.141	871	0.189	0.059	Q96DT7.pdb.gz	ZBT10_HUMAN Zinc finger and BTB domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ZBTB10 PE=1 SV=2
7	AFDB:P22670	0.085	0.037	2.156	979	0.141	0.039	P22670.pdb.gz	RFX1_HUMAN MHC class II regulatory factor RFX1 OS=Homo sapiens OX=9606 GN=RFX1 PE=1 SV=2
8	AFDB:Q03707	0.144	0.060	2.156	834	0.144	0.047	Q03707.pdb.gz	SRC1_YEAST Inner nuclear membrane protein SRC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SRC1 PE=1 SV=2
9	AFDB:Q62130	0.080	0.025	2.156	1189	0.148	0.034	Q62130.pdb.gz	PTN14_MOUSE Tyrosine-protein phosphatase non-receptor type 14 OS=Mus musculus OX=10090 GN=Ptpn14 PE=1 SV=2
10	AFDB:Q9ZWA6	0.085	0.050	2.156	506	0.137	0.073	Q9ZWA6.pdb.gz	IDD3_ARATH Zinc finger protein MAGPIE OS=Arabidopsis thaliana OX=3702 GN=MGP PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99967	0.0	545	270	1.000	1.000	CITE2_HUMAN Cbp/p300-interacting transactivator 2 OS=Homo sapiens OX=9606 GN=CITED2 PE=1 SV=2
2	Q99MA1	8.02e-155	434	269	0.919	0.922	Q99MA1_RAT Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 2 OS=Rattus norvegicus OX=10116 GN=Cited2 PE=2 SV=1
3	O35740	4.15e-154	432	269	0.915	0.918	CITE2_MOUSE Cbp/p300-interacting transactivator 2 OS=Mus musculus OX=10090 GN=Cited2 PE=1 SV=2
4	Q9I8K7	5.28e-29	111	205	0.381	0.502	CITE3_CHICK Cbp/p300-interacting transactivator 3 OS=Gallus gallus OX=9031 GN=CITED3 PE=2 SV=1
5	A8E5L7	3.34e-25	102	254	0.163	0.173	A8E5L7_DANRE Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 4b OS=Danio rerio OX=7955 GN=cited3 PE=2 SV=1
6	Q4V8P1	2.87e-20	88.2	203	0.211	0.281	Q4V8P1_RAT Cbp/p300-interacting transactivator with Glu/Asp-rich carboxy-terminal domain 1 OS=Rattus norvegicus OX=10116 GN=Cited1 PE=3 SV=1
7	Q99966	7.51e-20	86.7	193	0.200	0.280	CITE1_HUMAN Cbp/p300-interacting transactivator 1 OS=Homo sapiens OX=9606 GN=CITED1 PE=1 SV=2
8	P97769	2.10e-18	83.2	203	0.148	0.197	CITE1_MOUSE Cbp/p300-interacting transactivator 1 OS=Mus musculus OX=10090 GN=Cited1 PE=1 SV=1
9	Q9WUL8	1.40e-11	63.9	182	0.104	0.154	CITE4_MOUSE Cbp/p300-interacting transactivator 4 OS=Mus musculus OX=10090 GN=Cited4 PE=1 SV=1
10	Q96RK1	5.84e-11	62.4	184	0.100	0.147	CITE4_HUMAN Cbp/p300-interacting transactivator 4 OS=Homo sapiens OX=9606 GN=CITED4 PE=1 SV=1
11	P35207	0.028	38.1	1287	0.063	0.013	SKI2_YEAST Antiviral helicase SKI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKI2 PE=1 SV=2
12	Q8IRC0	0.046	37.4	898	0.104	0.031	Q8IRC0_DROME Ensconsin, isoform E OS=Drosophila melanogaster OX=7227 GN=ens PE=1 SV=2
13	Q8IRB9	0.076	37.0	983	0.104	0.028	Q8IRB9_DROME Ensconsin, isoform D OS=Drosophila melanogaster OX=7227 GN=ens PE=1 SV=2
14	F2FB68	0.53	34.3	848	0.093	0.029	F2FB68_DROME Ensconsin, isoform H OS=Drosophila melanogaster OX=7227 GN=ens PE=1 SV=1
15	Q9VZI0	0.53	34.3	851	0.093	0.029	Q9VZI0_DROME Ensconsin, isoform B OS=Drosophila melanogaster OX=7227 GN=ens PE=1 SV=3
16	Q8IRC1	0.55	34.3	833	0.093	0.030	Q8IRC1_DROME Ensconsin, isoform C OS=Drosophila melanogaster OX=7227 GN=ens PE=1 SV=2
17	Q9I7T2	0.66	33.9	887	0.093	0.028	Q9I7T2_DROME Ensconsin, isoform A OS=Drosophila melanogaster OX=7227 GN=ens PE=1 SV=2
18	M9PBN6	0.84	33.5	968	0.085	0.024	M9PBN6_DROME Ensconsin, isoform J OS=Drosophila melanogaster OX=7227 GN=ens PE=1 SV=1
19	M9PE93	0.87	33.5	1015	0.085	0.023	M9PE93_DROME Ensconsin, isoform K OS=Drosophila melanogaster OX=7227 GN=ens PE=1 SV=1
20	M9PHB1	1.2	33.1	1100	0.085	0.021	M9PHB1_DROME Ensconsin, isoform G OS=Drosophila melanogaster OX=7227 GN=ens PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04487 CITED	5.2e-105	361.7	CITED

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000444198

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262367	0.999	CREB-binding protein
2	9606.ENSP00000263253	0.999	Histone acetyltransferase p300
3	9606.ENSP00000362717	0.969	LIM/homeobox protein Lhx2
4	9606.ENSP00000437955	0.967	Hypoxia-inducible factor 1-alpha
5	9606.ENSP00000304169	0.946	Pituitary homeobox 2
6	9606.ENSP00000368924	0.941	Transcription factor AP-2-alpha
7	9606.ENSP00000263734	0.933	Endothelial PAS domain-containing protein 1
8	9606.ENSP00000385824	0.931	Forkhead box protein O3
9	9606.ENSP00000351407	0.929	Aryl hydrocarbon receptor nuclear translocator
10	9606.ENSP00000368880	0.922	Forkhead box protein O1
11	9606.ENSP00000385523	0.922	Peroxisome proliferator-activated receptor alpha
12	9606.ENSP00000366898	0.919	Hypoxia-inducible factor 3-alpha
13	9606.ENSP00000264867	0.918	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
14	9606.ENSP00000385216	0.916	Nuclear receptor coactivator 1
15	9606.ENSP00000295834	0.908	Fatty acid-binding protein, liver
16	9606.ENSP00000201031	0.906	Transcription factor AP-2 gamma
17	9606.ENSP00000383063	0.904	Nuclear receptor-interacting protein 1
18	9606.ENSP00000309757	0.903	Lipoprotein lipase
19	9606.ENSP00000080059	0.902	Histone deacetylase 7
20	9606.ENSP00000300651	0.902	Mediator of RNA polymerase II transcription subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003713	1.000	transcription coactivator activity
GO:0019899	0.988	enzyme binding
GO:0019904	0.969	protein domain specific binding
GO:0035035	0.940	histone acetyltransferase binding
GO:0003714	0.932	transcription corepressor activity
GO:0098772	0.927	molecular function regulator activity
GO:0140677	0.918	molecular function activator activity
GO:0050693	0.867	LBD domain binding
GO:0140297	0.437	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0009987	0.991	cellular process
GO:0048519	0.985	negative regulation of biological process
GO:0050896	0.983	response to stimulus
GO:0048522	0.977	positive regulation of cellular process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0007275	0.974	multicellular organism development
GO:0010468	0.971	regulation of gene expression
GO:0009719	0.966	response to endogenous stimulus
GO:0048523	0.966	negative regulation of cellular process
GO:0051716	0.959	cellular response to stimulus
GO:0051173	0.949	positive regulation of nitrogen compound metabolic process
GO:0006357	0.948	regulation of transcription by RNA polymerase II
GO:0010557	0.941	positive regulation of macromolecule biosynthetic process
GO:0051254	0.938	positive regulation of RNA metabolic process
GO:0045893	0.933	positive regulation of DNA-templated transcription
GO:0045944	0.923	positive regulation of transcription by RNA polymerase II
GO:0009892	0.904	negative regulation of metabolic process
GO:0048583	0.902	regulation of response to stimulus
GO:0010605	0.888	negative regulation of macromolecule metabolic process
GO:0006950	0.886	response to stress
GO:0008152	0.874	metabolic process
GO:0010646	0.870	regulation of cell communication
GO:0023051	0.845	regulation of signaling
GO:0042221	0.791	response to chemical
GO:0009966	0.788	regulation of signal transduction
GO:0048513	0.782	animal organ development
GO:0048731	0.720	system development
GO:0071704	0.703	organic substance metabolic process
GO:0050793	0.694	regulation of developmental process
GO:0048584	0.680	positive regulation of response to stimulus
GO:0051239	0.653	regulation of multicellular organismal process
GO:0051172	0.600	negative regulation of nitrogen compound metabolic process
GO:0070887	0.595	cellular response to chemical stimulus
GO:0044237	0.580	cellular metabolic process
GO:0044238	0.576	primary metabolic process
GO:0007154	0.543	cell communication
GO:0023052	0.522	signaling
GO:0051253	0.519	negative regulation of RNA metabolic process
GO:0010558	0.515	negative regulation of macromolecule biosynthetic process
GO:0045892	0.510	negative regulation of DNA-templated transcription
GO:0010628	0.483	positive regulation of gene expression
GO:0009628	0.482	response to abiotic stimulus
GO:0010033	0.456	response to organic substance
GO:0000122	0.432	negative regulation of transcription by RNA polymerase II
GO:0010647	0.430	positive regulation of cell communication
GO:0009967	0.415	positive regulation of signal transduction
GO:0006807	0.407	nitrogen compound metabolic process
GO:0070848	0.376	response to growth factor
GO:0071495	0.352	cellular response to endogenous stimulus
GO:0043170	0.344	macromolecule metabolic process
GO:0007165	0.330	signal transduction
GO:0010629	0.317	negative regulation of gene expression
GO:0033554	0.313	cellular response to stress
GO:0048869	0.302	cellular developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0043228	0.987	non-membrane-bounded organelle
GO:0043232	0.983	intracellular non-membrane-bounded organelle
GO:0005737	0.962	cytoplasm
GO:0032991	0.946	protein-containing complex
GO:0005694	0.893	chromosome
GO:0000785	0.883	chromatin
GO:0005829	0.393	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]