StarFunc result for job id Q99969

User Input

>input (163 residues)
MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPF
PAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIE
TQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99969	1.000	1.000	3.564E-29	163	1.000	1.000	Q99969.pdb.gz	RARR2_HUMAN Retinoic acid receptor responder protein 2 OS=Homo sapiens OX=9606 GN=RARRES2 PE=1 SV=1
2	AFDB:Q9DD06	0.800	0.805	1.405E-20	162	0.632	0.636	Q9DD06.pdb.gz	RARR2_MOUSE Retinoic acid receptor responder protein 2 OS=Mus musculus OX=10090 GN=Rarres2 PE=1 SV=1
3	AFDB:Q5BK77	0.756	0.756	1.764E-20	163	0.663	0.663	Q5BK77.pdb.gz	Q5BK77_RAT Retinoic acid receptor responder protein 2 OS=Rattus norvegicus OX=10116 GN=Rarres2 PE=2 SV=1
4	AFDB:Q62740	0.503	0.413	3.957E-6	203	0.153	0.123	Q62740.pdb.gz	SPP24_RAT Secreted phosphoprotein 24 OS=Rattus norvegicus OX=10116 GN=Spp2 PE=1 SV=2
5	AFDB:O08677	0.545	0.142	1.102E-5	661	0.190	0.047	O08677.pdb.gz	KNG1_MOUSE Kininogen-1 OS=Mus musculus OX=10090 GN=Kng1 PE=1 SV=1
6	AFDB:Q13103	0.489	0.388	1.550E-5	211	0.153	0.118	Q13103.pdb.gz	SPP24_HUMAN Secreted phosphoprotein 24 OS=Homo sapiens OX=9606 GN=SPP2 PE=1 SV=1
7	AFDB:G3V8S9	0.493	0.463	1.736E-5	175	0.141	0.131	G3V8S9.pdb.gz	G3V8S9_RAT Cathelicidin antimicrobial peptide OS=Rattus norvegicus OX=10116 GN=Camp PE=3 SV=1
8	AFDB:A0A1S3PBB7	0.514	0.235	1.838E-5	375	0.196	0.085	A0A1S3PBB7.pdb.gz	KNG_SALSA Kininogen OS=Salmo salar OX=8030 GN=LOC106584303 PE=1 SV=1
9	AFDB:P08934	0.502	0.138	2.442E-5	639	0.190	0.049	P08934.pdb.gz	KNG1_RAT Kininogen-1 OS=Rattus norvegicus OX=10116 GN=Kng1 PE=2 SV=1
10	AFDB:P51524	0.456	0.362	3.066E-5	212	0.160	0.123	P51524.pdb.gz	PF11_PIG Prophenin and tritrpticin precursor (Fragment) OS=Sus scrofa OX=9823 PE=1 SV=1
11	PDB:3lh4A	0.494	0.674	1.924E-4	115	0.098	0.139	3lh4A.pdb.gz
12	PDB:1wnhA	0.398	0.305	2.706E-4	220	0.110	0.082	1wnhA.pdb.gz
13	PDB:4n6mA	0.461	0.622	2.706E-4	117	0.104	0.145	4n6mA.pdb.gz
14	PDB:2ch9A	0.455	0.570	3.398E-4	126	0.098	0.127	2ch9A.pdb.gz	Structural Basis of Reduction-Dependent Activation of Human Cystatin F.
15	PDB:2bo9B	0.397	0.309	4.266E-4	217	0.123	0.092	2bo9B.pdb.gz	Structure of Human Carboxypeptidase A4 with its Endogenous Protein Inhibitor, Latexin.
16	PDB:6uioA	0.476	0.666	1.491E-3	112	0.074	0.107	6uioA.pdb.gz	Maturation of the functional mouse CRES amyloid from globular form.
17	PDB:1yvbI	0.498	0.703	1.768E-3	111	0.129	0.189	1yvbI.pdb.gz
18	PDB:1rn7A	0.460	0.636	2.097E-3	112	0.110	0.161	1rn7A.pdb.gz
19	PDB:6ht9B	0.454	0.246	4.392E-3	316	0.086	0.044	6ht9B.pdb.gz	Structure of mammalian plasma fetuin-B and its mechanism of selective metallopeptidase inhibition.
20	PDB:4m4dA	0.191	0.092	8.455E-2	448	0.098	0.036	4m4dA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99969	2.44e-118	332	163	1.000	1.000	RARR2_HUMAN Retinoic acid receptor responder protein 2 OS=Homo sapiens OX=9606 GN=RARRES2 PE=1 SV=1
2	F7FP65	1.41e-72	217	162	0.663	0.667	F7FP65_RAT Retinoic acid receptor responder protein 2 OS=Rattus norvegicus OX=10116 GN=Rarres2 PE=1 SV=1
3	Q5BK77	2.10e-72	216	163	0.663	0.663	Q5BK77_RAT Retinoic acid receptor responder protein 2 OS=Rattus norvegicus OX=10116 GN=Rarres2 PE=2 SV=1
4	Q9DD06	3.38e-70	211	162	0.632	0.636	RARR2_MOUSE Retinoic acid receptor responder protein 2 OS=Mus musculus OX=10090 GN=Rarres2 PE=1 SV=1
5	A0A8I6AUZ6	3.98e-41	138	186	0.417	0.366	A0A8I6AUZ6_RAT Retinoic acid receptor responder protein 2 OS=Rattus norvegicus OX=10116 GN=Rarres2 PE=1 SV=1
6	P9WMY9	1.7	31.2	414	0.135	0.053	GLGSY_MYCTU Glycogen synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3032 PE=1 SV=1
7	Q2KSZ4	2.2	30.4	208	0.129	0.101	Q2KSZ4_ONCMY Cathelicidin-derived antimicrobial peptide 2 isoform A OS=Oncorhynchus mykiss OX=8022 GN=CATH-2A PE=4 SV=1
8	Q49TU6	3.6	29.6	208	0.129	0.101	Q49TU6_ONCMY Cathelicidin antimicrobial peptide OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
9	Q08G22	3.7	29.6	208	0.129	0.101	Q08G22_ONCMY Cathelicidin-derived antimicrobial peptide 2 isoform A OS=Oncorhynchus mykiss OX=8022 GN=CATH-2A PE=4 SV=1
10	A0A0F6QFC0	4.7	29.3	192	0.129	0.109	A0A0F6QFC0_ONCMY Cathelicidin-derived antimicrobial peptide 2b OS=Oncorhynchus mykiss OX=8022 GN=CATH-2b PE=2 SV=1
11	Q08G23	5.5	29.3	192	0.129	0.109	Q08G23_ONCMY Cathelicidin-derived antimicrobial peptide 2 isoform B OS=Oncorhynchus mykiss OX=8022 GN=CATH-2B PE=4 SV=1
12	Q8LPD9	5.9	29.6	749	0.110	0.024	PHOT_CHLRE Phototropin OS=Chlamydomonas reinhardtii OX=3055 GN=PHOT PE=1 SV=1
13	Q49TU5	7.5	28.9	202	0.129	0.104	Q49TU5_SALSA Cathelicidin antimicrobial peptide OS=Salmo salar OX=8030 GN=LOC100136439 PE=2 SV=1
14	Q21086	8.3	29.3	556	0.153	0.045	GNL3_CAEEL Guanine nucleotide-binding protein-like 3 homolog OS=Caenorhabditis elegans OX=6239 GN=nst-1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00666 Cathelicidins	98	14.7	Cathelicidin
2	PF07448 Spp-24	34	16.0	Secreted phosphoprotein 24 (Spp-24) cystatin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000418009

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000311733	0.992	Chemokine-like receptor 1
2	9606.ENSP00000480405	0.988	G-protein coupled receptor 1
3	9606.ENSP00000349967	0.986	C-C chemokine receptor-like 2
4	9606.ENSP00000248114	0.822	FAD-linked sulfhydryl oxidase ALR
5	9606.ENSP00000342109	0.808	Serpin A12
6	9606.ENSP00000323587	0.802	Intelectin-1
7	9606.ENSP00000389814	0.758	Adiponectin
8	9606.ENSP00000221515	0.754	Resistin
9	9606.ENSP00000222553	0.748	Nicotinamide phosphoribosyltransferase
10	9606.ENSP00000380008	0.730	Leukotriene B4 receptor 1
11	9606.ENSP00000312652	0.716	Leptin
12	9606.ENSP00000360522	0.700	Retinol-binding protein 4
13	9606.ENSP00000391800	0.638	Apelin
14	9606.ENSP00000225831	0.609	C-C motif chemokine 2
15	9606.ENSP00000255030	0.603	C-reactive protein
16	9606.ENSP00000380432	0.602	Insulin
17	9606.ENSP00000367832	0.596	C-C motif chemokine 7
18	9606.ENSP00000385675	0.562	Interleukin-6
19	9606.ENSP00000181383	0.559	Carboxypeptidase B2
20	9606.ENSP00000398698	0.530	Tumor necrosis factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.988	biological regulation
GO:0071310	0.986	cellular response to organic substance
GO:0050794	0.979	regulation of cellular process
GO:0032501	0.975	multicellular organismal process
GO:0048518	0.965	positive regulation of biological process
GO:0071495	0.957	cellular response to endogenous stimulus
GO:0006950	0.920	response to stress
GO:0009605	0.913	response to external stimulus
GO:0048522	0.904	positive regulation of cellular process
GO:1901701	0.900	cellular response to oxygen-containing compound
GO:0043434	0.895	response to peptide hormone
GO:0007154	0.841	cell communication
GO:0060255	0.821	regulation of macromolecule metabolic process
GO:0048583	0.803	regulation of response to stimulus
GO:0023052	0.796	signaling
GO:0051246	0.743	regulation of protein metabolic process
GO:0040012	0.740	regulation of locomotion
GO:0031323	0.729	regulation of cellular metabolic process
GO:0032101	0.723	regulation of response to external stimulus
GO:0010604	0.716	positive regulation of macromolecule metabolic process
GO:0048584	0.712	positive regulation of response to stimulus
GO:0031401	0.679	positive regulation of protein modification process
GO:0001934	0.673	positive regulation of protein phosphorylation
GO:0040017	0.663	positive regulation of locomotion
GO:0007165	0.656	signal transduction
GO:0032103	0.639	positive regulation of response to external stimulus
GO:0032502	0.576	developmental process
GO:0071417	0.538	cellular response to organonitrogen compound
GO:0032870	0.537	cellular response to hormone stimulus
GO:0002376	0.489	immune system process
GO:0032868	0.485	response to insulin
GO:0030335	0.478	positive regulation of cell migration
GO:0050920	0.463	regulation of chemotaxis
GO:0006952	0.462	defense response
GO:0048519	0.457	negative regulation of biological process
GO:1901653	0.452	cellular response to peptide
GO:0008152	0.448	metabolic process
GO:0002682	0.448	regulation of immune system process
GO:0006955	0.421	immune response
GO:0050921	0.421	positive regulation of chemotaxis
GO:0002684	0.407	positive regulation of immune system process
GO:0048856	0.401	anatomical structure development
GO:0023051	0.391	regulation of signaling
GO:0010646	0.391	regulation of cell communication
GO:0002685	0.387	regulation of leukocyte migration
GO:0009966	0.371	regulation of signal transduction
GO:0048523	0.357	negative regulation of cellular process
GO:0098542	0.353	defense response to other organism
GO:0065008	0.332	regulation of biological quality
GO:0007275	0.332	multicellular organism development
GO:0002690	0.330	positive regulation of leukocyte chemotaxis
GO:0032869	0.326	cellular response to insulin stimulus
GO:0071704	0.303	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0005622	0.998	intracellular anatomical structure
GO:0043227	0.998	membrane-bounded organelle
GO:0005737	0.992	cytoplasm
GO:0070013	0.987	intracellular organelle lumen
GO:0012505	0.986	endomembrane system
GO:0043231	0.985	intracellular membrane-bounded organelle
GO:0031982	0.970	vesicle
GO:0071944	0.966	cell periphery
GO:0060205	0.945	cytoplasmic vesicle lumen
GO:0030141	0.907	secretory granule
GO:0034774	0.882	secretory granule lumen
GO:0065010	0.747	extracellular membrane-bounded organelle
GO:0070062	0.703	extracellular exosome
GO:0030312	0.698	external encapsulating structure
GO:0031012	0.604	extracellular matrix
GO:0042827	0.563	platelet dense granule
GO:0062023	0.536	collagen-containing extracellular matrix
GO:0016020	0.357	membrane
GO:0005886	0.300	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]