StarFunc result for job id Q99972

User Input

>input (504 residues)
MRFFCARCCSFGPEMPAVQLLLLACLVWDVGARTAQLRKANDQSGRCQYTFSVASPNESS
CPEQSQAMSVIHNLQRDSSTQRLDLEATKARLSSLESLLHQLTLDQAARPQETQEGLQRE
LGTLRRERDQLETQTRELETAYSNLLRDKSVLEEEKKRLRQENENLARRLESSSQEVARL
RRGQCPQTRDTARAVPPGSREVSTWNLDTLAFQELKSELTEVPASRILKESPSGYLRSGE
GDTGCGELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPYTQETTWRIDTVGTDVRQVFE
YDLISQFMQGYPSKVHILPRPLESTGAVVYSGSLYFQGAESRTVIRYELNTETVKAEKEI
PGAGYHGQFPYSWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETN
IRKQSVANAFIICGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYN
PLEKKLFAWDNLNMVTYDIKLSKM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99972	1.000	1.000	1.744E-94	504	1.000	1.000	Q99972.pdb.gz	MYOC_HUMAN Myocilin OS=Homo sapiens OX=9606 GN=MYOC PE=1 SV=2
2	AFDB:Q9R1J4	0.837	0.840	2.467E-79	502	0.808	0.811	Q9R1J4.pdb.gz	MYOC_RAT Myocilin OS=Rattus norvegicus OX=10116 GN=Myoc PE=2 SV=1
3	AFDB:F1R5K6	0.496	0.518	3.270E-37	483	0.258	0.269	F1R5K6.pdb.gz	F1R5K6_DANRE Noelin-2 isoform X1 OS=Danio rerio OX=7955 GN=olfm2 PE=4 SV=1
4	AFDB:P63056	0.493	0.520	5.698E-37	478	0.244	0.257	P63056.pdb.gz	NOE3_MOUSE Noelin-3 OS=Mus musculus OX=10090 GN=Olfm3 PE=1 SV=1
5	AFDB:Q568Y7	0.495	0.522	1.549E-36	478	0.260	0.274	Q568Y7.pdb.gz	NOE2_RAT Noelin-2 OS=Rattus norvegicus OX=10116 GN=Olfm2 PE=1 SV=1
6	AFDB:O88998	0.493	0.512	1.597E-35	485	0.268	0.278	O88998.pdb.gz	NOE1_MOUSE Noelin OS=Mus musculus OX=10090 GN=Olfm1 PE=1 SV=1
7	AFDB:A2AWU1	0.488	0.506	7.564E-35	485	0.266	0.276	A2AWU1.pdb.gz	A2AWU1_DANRE Olfactomedin 1a OS=Danio rerio OX=7955 GN=zgc:111962 PE=4 SV=1
8	AFDB:A0A024QZ95	0.495	0.489	2.974E-31	510	0.210	0.208	A0A024QZ95.pdb.gz
9	AFDB:O95490	0.488	0.170	8.334E-30	1459	0.179	0.062	O95490.pdb.gz	AGRL2_HUMAN Adhesion G protein-coupled receptor L2 OS=Homo sapiens OX=9606 GN=ADGRL2 PE=1 SV=2
10	PDB:5amoB	0.463	0.898	1.373E-29	257	0.192	0.377	5amoB.pdb.gz
11	AFDB:Q8BHP7	0.476	0.355	1.536E-29	681	0.204	0.151	Q8BHP7.pdb.gz	OLM2A_MOUSE Olfactomedin-like protein 2A OS=Mus musculus OX=10090 GN=Olfml2a PE=1 SV=1
12	PDB:3jb9L	0.251	0.386	2.840E-7	293	0.044	0.075	3jb9L.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
13	PDB:5mzhB	0.255	0.297	8.626E-7	415	0.050	0.060	5mzhB.pdb.gz
14	PDB:8gqeA	0.256	0.345	1.139E-6	348	0.089	0.129	8gqeA.pdb.gz
15	PDB:5yzgs	0.260	0.333	1.345E-6	374	0.058	0.078	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
16	PDB:7vggA	0.255	0.376	1.345E-6	304	0.052	0.086	7vggA.pdb.gz
17	PDB:5o9zL	0.258	0.279	1.877E-6	459	0.058	0.063	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
18	PDB:7zgrD	0.252	0.308	2.345E-6	395	0.036	0.046	7zgrD.pdb.gz	Mpe1 senses the binding of pre-mRNA and controls 3' end processing by CPF.
19	PDB:7jvrB	0.290	0.394	3.459E-6	342	0.052	0.076	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
20	PDB:7d5sB2	0.273	0.175	4.086E-6	851	0.044	0.026	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O70624	0.0	842	490	0.796	0.818	MYOC_MOUSE Myocilin OS=Mus musculus OX=10090 GN=Myoc PE=1 SV=1
2	Q99972	0.0	1043	504	1.000	1.000	MYOC_HUMAN Myocilin OS=Homo sapiens OX=9606 GN=MYOC PE=1 SV=2
3	Q9R1J4	0.0	853	502	0.808	0.811	MYOC_RAT Myocilin OS=Rattus norvegicus OX=10116 GN=Myoc PE=2 SV=1
4	Q9IAK4	8.44e-69	230	485	0.266	0.276	NOE1_CHICK Noelin OS=Gallus gallus OX=9031 GN=OLFM1 PE=1 SV=1
5	Q99784	2.03e-67	226	485	0.264	0.274	NOE1_HUMAN Noelin OS=Homo sapiens OX=9606 GN=OLFM1 PE=1 SV=4
6	K7EIS8	3.06e-67	223	376	0.204	0.274	K7EIS8_HUMAN Olfactomedin 2 OS=Homo sapiens OX=9606 GN=OLFM2 PE=1 SV=1
7	Q803W5	5.55e-67	224	444	0.264	0.300	Q803W5_DANRE Noelin-2 OS=Danio rerio OX=7955 GN=olfm2 PE=2 SV=1
8	A0A286Y8W4	5.67e-67	224	454	0.264	0.293	A0A286Y8W4_DANRE Noelin-2 isoform X2 OS=Danio rerio OX=7955 GN=olfm2 PE=4 SV=1
9	Q8BM13	6.41e-67	224	448	0.204	0.230	NOE2_MOUSE Noelin-2 OS=Mus musculus OX=10090 GN=Olfm2 PE=1 SV=2
10	O88998	6.89e-67	225	485	0.264	0.274	NOE1_MOUSE Noelin OS=Mus musculus OX=10090 GN=Olfm1 PE=1 SV=1
11	O95897	7.45e-67	224	454	0.256	0.284	NOE2_HUMAN Noelin-2 OS=Homo sapiens OX=9606 GN=OLFM2 PE=1 SV=2
12	F1R5K6	1.26e-66	224	483	0.264	0.275	F1R5K6_DANRE Noelin-2 isoform X1 OS=Danio rerio OX=7955 GN=olfm2 PE=4 SV=1
13	Q568Y7	1.77e-66	224	478	0.204	0.215	NOE2_RAT Noelin-2 OS=Rattus norvegicus OX=10116 GN=Olfm2 PE=1 SV=1
14	A2AWU3	1.59e-65	221	457	0.292	0.322	A2AWU3_DANRE Olfactomedin 1a OS=Danio rerio OX=7955 GN=zgc:111962 PE=4 SV=1
15	A2AWU1	4.38e-65	220	485	0.292	0.303	A2AWU1_DANRE Olfactomedin 1a OS=Danio rerio OX=7955 GN=zgc:111962 PE=4 SV=1
16	Q96PB7	1.68e-59	205	478	0.292	0.308	NOE3_HUMAN Noelin-3 OS=Homo sapiens OX=9606 GN=OLFM3 PE=1 SV=1
17	P63056	2.66e-59	204	478	0.286	0.301	NOE3_MOUSE Noelin-3 OS=Mus musculus OX=10090 GN=Olfm3 PE=1 SV=1
18	P63057	2.66e-59	204	478	0.286	0.301	NOE3_RAT Noelin-3 OS=Rattus norvegicus OX=10116 GN=Olfm3 PE=1 SV=1
19	Q80TS3	7.90e-51	189	1537	0.185	0.061	AGRL3_MOUSE Adhesion G protein-coupled receptor L3 OS=Mus musculus OX=10090 GN=Adgrl3 PE=1 SV=3
20	Q9HAR2	8.73e-51	189	1447	0.185	0.064	AGRL3_HUMAN Adhesion G protein-coupled receptor L3 OS=Homo sapiens OX=9606 GN=ADGRL3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17675 APG6_N	1.7e+02	14.1	Apg6 coiled-coil region
2	PF08614 ATG16	49	15.6	Autophagy protein 16 (ATG16)
3	PF08647 BRE1	68	14.9	BRE1 E3 ubiquitin ligase
4	PF06657 Cep57_MT_bd	3e+02	13.3	Centrosome microtubule-binding domain of Cep57
5	PF02601 Exonuc_VII_L	8.4e+02	10.9	Exonuclease VII, large subunit
6	PF05911 FPP	1.3e+02	12.2	Filament-like plant protein, long coiled-coil
7	PF14932 HAUS-augmin3	2.2e+02	12.7	HAUS augmin-like complex subunit 3
8	PF14775 NYD-SP28_assoc	34	15.9	Sperm tail C-terminal domain
9	PF02191 OLF	4.3e-81	283.7	Olfactomedin-like domain
10	PF08317 Spc7	56	14.5	Spc7 kinetochore protein
11	PF06156 YabA	8.6e+02	12.0	Initiation control protein YabA

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000037502

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000423067	0.951	WD repeat-containing protein 36
2	9606.ENSP00000346839	0.885	Fibronectin type III domain containing
3	9606.ENSP00000368022	0.880	Optineurin
4	9606.ENSP00000391601	0.869	Peroxisomal targeting signal 1 receptor
5	9606.ENSP00000478561	0.822	Cytochrome P450 1B1
6	9606.ENSP00000228841	0.793	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
7	9606.ENSP00000442046	0.790	Transmembrane and tetratricopeptide repeat containing 1
8	9606.ENSP00000414856	0.784	SPARC-like protein 1
9	9606.ENSP00000286574	0.775	Wnt inhibitory factor 1
10	9606.ENSP00000417161	0.769	G-protein coupled receptor 143
11	9606.ENSP00000391137	0.741	Ankyrin repeat and SOCS box protein 10
12	9606.ENSP00000365569	0.726	Flotillin-1
13	9606.ENSP00000299767	0.716	Endoplasmin
14	9606.ENSP00000343629	0.713	Protein PRRC2C
15	9606.ENSP00000347451	0.711	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1
16	9606.ENSP00000480514	0.702	Calcium load-activated calcium channel
17	9606.ENSP00000320866	0.699	Calreticulin
18	9606.ENSP00000371307	0.698	Phospholipid phosphatase 6
19	9606.ENSP00000469455	0.681	Neurotrophin-4
20	9606.ENSP00000261978	0.669	Latent-transforming growth factor beta-binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding
GO:0001968	0.964	fibronectin binding
GO:0005109	0.963	frizzled binding
GO:0017022	0.962	myosin binding
GO:0032027	0.954	myosin light chain binding
GO:0042802	0.501	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.991	response to stimulus
GO:0009987	0.988	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0051716	0.963	cellular response to stimulus
GO:0032501	0.962	multicellular organismal process
GO:0023052	0.960	signaling
GO:0007154	0.956	cell communication
GO:0007165	0.950	signal transduction
GO:0048856	0.940	anatomical structure development
GO:0048518	0.928	positive regulation of biological process
GO:0007275	0.912	multicellular organism development
GO:0048522	0.902	positive regulation of cellular process
GO:0048731	0.898	system development
GO:0071840	0.862	cellular component organization or biogenesis
GO:0007399	0.861	nervous system development
GO:0016043	0.850	cellular component organization
GO:0048519	0.800	negative regulation of biological process
GO:0048523	0.789	negative regulation of cellular process
GO:0048583	0.772	regulation of response to stimulus
GO:0030154	0.765	cell differentiation
GO:0023051	0.758	regulation of signaling
GO:0010646	0.752	regulation of cell communication
GO:0009966	0.743	regulation of signal transduction
GO:0010810	0.727	regulation of cell-substrate adhesion
GO:0045785	0.715	positive regulation of cell adhesion
GO:1900024	0.695	regulation of substrate adhesion-dependent cell spreading
GO:0010811	0.667	positive regulation of cell-substrate adhesion
GO:1902531	0.652	regulation of intracellular signal transduction
GO:0051128	0.648	regulation of cellular component organization
GO:0007166	0.620	cell surface receptor signaling pathway
GO:1902903	0.612	regulation of supramolecular fiber organization
GO:0001503	0.607	ossification
GO:0032970	0.596	regulation of actin filament-based process
GO:0032956	0.592	regulation of actin cytoskeleton organization
GO:1900026	0.581	positive regulation of substrate adhesion-dependent cell spreading
GO:0150116	0.540	regulation of cell-substrate junction organization
GO:0110053	0.525	regulation of actin filament organization
GO:0110020	0.520	regulation of actomyosin structure organization
GO:0032231	0.520	regulation of actin filament bundle assembly
GO:0048584	0.486	positive regulation of response to stimulus
GO:0051492	0.474	regulation of stress fiber assembly
GO:0001952	0.458	regulation of cell-matrix adhesion
GO:0009967	0.452	positive regulation of signal transduction
GO:1902533	0.418	positive regulation of intracellular signal transduction
GO:0014066	0.400	regulation of phosphatidylinositol 3-kinase signaling
GO:0001649	0.384	osteoblast differentiation
GO:0022008	0.322	neurogenesis
GO:0065008	0.310	regulation of biological quality
GO:0048468	0.304	cell development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005576	0.997	extracellular region
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0012505	0.993	endomembrane system
GO:0071944	0.946	cell periphery
GO:0016020	0.942	membrane
GO:0031974	0.932	membrane-enclosed lumen
GO:0070013	0.854	intracellular organelle lumen
GO:0005615	0.828	extracellular space
GO:0031982	0.729	vesicle
GO:0043230	0.724	extracellular organelle
GO:0065010	0.703	extracellular membrane-bounded organelle
GO:0031090	0.670	organelle membrane
GO:1903561	0.655	extracellular vesicle
GO:0005794	0.636	Golgi apparatus
GO:0030312	0.489	external encapsulating structure
GO:0070062	0.482	extracellular exosome
GO:0031012	0.426	extracellular matrix
GO:0005634	0.397	nucleus
GO:0005829	0.396	cytosol
GO:0031975	0.329	envelope
GO:0031410	0.303	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]