StarFunc result for job id Q99988

User Input

>input (308 residues)
MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDSRFRELRKRY
EDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRL
HRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQL
ELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMC
IGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDL
LAKDCHCI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G7PWZ3	0.603	0.603	3.157E-48	308	0.916	0.916	G7PWZ3.pdb.gz	GDF15_MACFA Growth/differentiation factor 15 OS=Macaca fascicularis OX=9541 GN=GDF15 PE=1 SV=1
2	AFDB:Q9Z0J6	0.472	0.480	2.621E-36	303	0.571	0.581	Q9Z0J6.pdb.gz	GDF15_RAT Growth/differentiation factor 15 OS=Rattus norvegicus OX=10116 GN=Gdf15 PE=1 SV=1
3	AFDB:G5EEL5	0.333	0.283	5.871E-15	365	0.260	0.219	G5EEL5.pdb.gz	DBL1_CAEEL Protein dbl-1 OS=Caenorhabditis elegans OX=6239 GN=dbl-1 PE=1 SV=1
4	AFDB:P01137	0.383	0.321	8.508E-14	390	0.227	0.179	P01137.pdb.gz	TGFB1_HUMAN Transforming growth factor beta-1 proprotein OS=Homo sapiens OX=9606 GN=TGFB1 PE=1 SV=3
5	AFDB:D4A7P9	0.311	0.317	1.180E-13	302	0.179	0.182	D4A7P9.pdb.gz	D4A7P9_RAT Bone morphogenetic protein 5 OS=Rattus norvegicus OX=10116 GN=Bmp5 PE=3 SV=3
6	AFDB:O13108	0.319	0.245	1.247E-13	411	0.224	0.168	O13108.pdb.gz
7	AFDB:P34821	0.293	0.229	2.676E-13	399	0.234	0.180	P34821.pdb.gz	BMP8A_MOUSE Bone morphogenetic protein 8A OS=Mus musculus OX=10090 GN=Bmp8a PE=2 SV=1
8	AFDB:Q9PTF9	0.305	0.223	2.826E-13	432	0.198	0.141	Q9PTF9.pdb.gz	Q9PTF9_DANRE Bone morphogenetic protein 7 OS=Danio rerio OX=7955 GN=Bmp7 PE=2 SV=1
9	AFDB:Q07104	0.323	0.277	4.373E-13	366	0.237	0.199	Q07104.pdb.gz	GDF3_MOUSE Growth/differentiation factor 3 OS=Mus musculus OX=10090 GN=Gdf3 PE=1 SV=2
10	AFDB:E9PTU9	0.310	0.249	5.150E-13	391	0.195	0.153	E9PTU9.pdb.gz	E9PTU9_RAT Bone morphogenetic protein 15 OS=Rattus norvegicus OX=10116 GN=Bmp15 PE=3 SV=1
11	PDB:5vqfB	0.313	0.305	2.392E-9	320	0.182	0.175	5vqfB.pdb.gz
12	PDB:3rjrC	0.297	0.275	6.388E-9	343	0.227	0.204	3rjrC.pdb.gz
13	PDB:5hlyA	0.299	0.305	9.359E-9	299	0.172	0.177	5hlyA.pdb.gz
14	PDB:5ffoG	0.314	0.321	1.102E-8	297	0.175	0.182	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
15	PDB:7y1rB	0.299	0.299	1.229E-8	308	0.195	0.195	7y1rB.pdb.gz
16	PDB:5ntuA	0.277	0.277	3.867E-8	308	0.159	0.159	5ntuA.pdb.gz
17	PDB:5nxsA	0.299	0.314	1.216E-7	290	0.136	0.145	5nxsA.pdb.gz
18	PDB:6umxA	0.234	0.252	7.361E-7	279	0.133	0.147	6umxA.pdb.gz
19	PDB:6q2sA	0.219	0.568	1.114E-4	98	0.088	0.276	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.
20	PDB:5nxsB	0.241	0.281	1.632E-4	251	0.162	0.199	5nxsB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G7PWZ3	0.0	529	308	0.916	0.916	GDF15_MACFA Growth/differentiation factor 15 OS=Macaca fascicularis OX=9541 GN=GDF15 PE=1 SV=1
2	Q99988	0.0	615	308	1.000	1.000	GDF15_HUMAN Growth/differentiation factor 15 OS=Homo sapiens OX=9606 GN=GDF15 PE=1 SV=3
3	Q9Z0J7	3.71e-112	328	303	0.571	0.581	GDF15_MOUSE Growth/differentiation factor 15 OS=Mus musculus OX=10090 GN=Gdf15 PE=1 SV=2
4	Q9Z0J6	6.12e-108	318	303	0.552	0.561	GDF15_RAT Growth/differentiation factor 15 OS=Rattus norvegicus OX=10116 GN=Gdf15 PE=1 SV=1
5	G5EEL5	3.64e-18	85.9	365	0.146	0.123	DBL1_CAEEL Protein dbl-1 OS=Caenorhabditis elegans OX=6239 GN=dbl-1 PE=1 SV=1
6	G3V6W8	1.16e-16	82.0	430	0.114	0.081	G3V6W8_RAT Bone morphogenetic protein 7 OS=Rattus norvegicus OX=10116 GN=Bmp7 PE=3 SV=1
7	P23359	1.16e-16	82.0	430	0.114	0.081	BMP7_MOUSE Bone morphogenetic protein 7 OS=Mus musculus OX=10090 GN=Bmp7 PE=1 SV=2
8	A0A8I6A920	1.32e-16	81.3	364	0.114	0.096	A0A8I6A920_RAT Bone morphogenetic protein 7 OS=Rattus norvegicus OX=10116 GN=Bmp7 PE=3 SV=1
9	P27091	2.16e-16	81.3	455	0.120	0.081	60A_DROME Protein 60A OS=Drosophila melanogaster OX=7227 GN=gbb PE=1 SV=1
10	P22003	2.28e-16	81.3	454	0.143	0.097	BMP5_HUMAN Bone morphogenetic protein 5 OS=Homo sapiens OX=9606 GN=BMP5 PE=1 SV=1
11	P35621	2.42e-16	80.5	355	0.127	0.110	DVR1_DANRE Protein DVR-1 OS=Danio rerio OX=7955 GN=dvr1 PE=2 SV=1
12	D4A7P9	2.94e-16	80.9	454	0.143	0.097	D4A7P9_RAT Bone morphogenetic protein 5 OS=Rattus norvegicus OX=10116 GN=Bmp5 PE=3 SV=3
13	Q98950	3.39e-16	80.5	373	0.110	0.091	Q98950_CHICK CVg1 protein OS=Gallus gallus OX=9031 GN=cVg1 PE=2 SV=1
14	P49003	3.66e-16	80.9	452	0.143	0.097	BMP5_MOUSE Bone morphogenetic protein 5 OS=Mus musculus OX=10090 GN=Bmp5 PE=1 SV=1
15	A8K571	4.56e-16	80.5	431	0.110	0.079	A8K571_HUMAN Bone morphogenetic protein 7 (Osteogenic protein 1), isoform CRA_b OS=Homo sapiens OX=9606 GN=BMP7 PE=1 SV=1
16	P18075	4.56e-16	80.5	431	0.110	0.079	BMP7_HUMAN Bone morphogenetic protein 7 OS=Homo sapiens OX=9606 GN=BMP7 PE=1 SV=1
17	Q9YGV1	4.75e-16	79.7	354	0.127	0.110	GDF3_XENLA Growth/differentiation factor 3 OS=Xenopus laevis OX=8355 GN=gdf3 PE=1 SV=1
18	Q9I8T6	5.67e-16	79.7	398	0.110	0.085	Q9I8T6_CHICK Bone morphogenetic protein 7 (Fragment) OS=Gallus gallus OX=9031 GN=BMP7 PE=2 SV=1
19	P22004	6.03e-16	80.1	513	0.114	0.068	BMP6_HUMAN Bone morphogenetic protein 6 OS=Homo sapiens OX=9606 GN=BMP6 PE=1 SV=1
20	Q04906	1.01e-15	79.7	506	0.110	0.067	BMP6_RAT Bone morphogenetic protein 6 OS=Rattus norvegicus OX=10116 GN=Bmp6 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10090 HPTransfase	4e+02	12.1	Histidine phosphotransferase C-terminal domain
2	PF00019 TGF_beta	3.6e-19	80.9	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000252809

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343636	0.997	GDNF family receptor alpha like
2	9606.ENSP00000351905	0.936	TGF-beta receptor type-2
3	9606.ENSP00000347942	0.891	Proto-oncogene tyrosine-protein kinase receptor Ret
4	9606.ENSP00000262120	0.878	Twisted gastrulation protein homolog 1
5	9606.ENSP00000471894	0.702	Hepcidin
6	9606.ENSP00000256951	0.678	Epithelial membrane protein 1
7	9606.ENSP00000442304	0.673	Erythroferrone
8	9606.ENSP00000230048	0.666	Acyl-coenzyme A thioesterase 13
9	9606.ENSP00000397178	0.664	Zinc finger protein 300
10	9606.ENSP00000265342	0.660	Follistatin-related protein 4
11	9606.ENSP00000309606	0.660	Zinc finger protein 408
12	9606.ENSP00000442308	0.660	NF-kappa-B-repressing factor
13	9606.ENSP00000324763	0.659	WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1
14	9606.ENSP00000254301	0.656	Galectin-3
15	9606.ENSP00000418751	0.652	BTB/POZ domain-containing protein 9
16	9606.ENSP00000385689	0.651	GRAM domain-containing protein 4
17	9606.ENSP00000303942	0.647	Platelet glycoprotein IX
18	9606.ENSP00000364261	0.647	OTU domain-containing protein 3
19	9606.ENSP00000435373	0.647	Cyclin-J
20	9606.ENSP00000295379	0.645	Bone morphogenetic protein 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	1.000	protein homodimerization activity
GO:0048018	0.998	receptor ligand activity
GO:0005125	0.831	cytokine activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0002021	0.996	response to dietary excess
GO:0050794	0.985	regulation of cellular process
GO:0009987	0.982	cellular process
GO:0048518	0.968	positive regulation of biological process
GO:0048522	0.964	positive regulation of cellular process
GO:0007631	0.947	feeding behavior
GO:0042755	0.921	eating behavior
GO:0048583	0.869	regulation of response to stimulus
GO:0023051	0.831	regulation of signaling
GO:0010646	0.806	regulation of cell communication
GO:0051716	0.788	cellular response to stimulus
GO:0023056	0.681	positive regulation of signaling
GO:0010647	0.681	positive regulation of cell communication
GO:0009966	0.665	regulation of signal transduction
GO:0007154	0.627	cell communication
GO:0048584	0.624	positive regulation of response to stimulus
GO:0048519	0.559	negative regulation of biological process
GO:0009967	0.550	positive regulation of signal transduction
GO:0023052	0.515	signaling
GO:0007165	0.482	signal transduction
GO:0048523	0.479	negative regulation of cellular process
GO:0019222	0.464	regulation of metabolic process
GO:0060255	0.429	regulation of macromolecule metabolic process
GO:0009893	0.367	positive regulation of metabolic process
GO:0031323	0.360	regulation of cellular metabolic process
GO:0051239	0.355	regulation of multicellular organismal process
GO:0080090	0.345	regulation of primary metabolic process
GO:0051171	0.344	regulation of nitrogen compound metabolic process
GO:0032502	0.338	developmental process
GO:1902531	0.319	regulation of intracellular signal transduction
GO:0010604	0.314	positive regulation of macromolecule metabolic process
GO:0007166	0.305	cell surface receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0043226	0.922	organelle
GO:0043227	0.896	membrane-bounded organelle
GO:0005622	0.852	intracellular anatomical structure
GO:0005737	0.820	cytoplasm
GO:0043231	0.816	intracellular membrane-bounded organelle
GO:0071944	0.627	cell periphery
GO:0012505	0.594	endomembrane system
GO:0005615	0.440	extracellular space
GO:0005634	0.407	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]