StarFunc result for job id Q99996

User Input

>input (1400 residues)
MEDEERQKKLEAGKAKLAQFRQRKAQSDGQSPSKKQKKKRKTSSSKHDVSAHHDLNIDQS
QCNEMYINSSQRVESTVIPESTIMRTLHSGEITSHEQGFSVELESEISTTADDCSSEVNG
CSFVMRTGKPTNLLREEEFGVDDSYSEQGAQDSPTHLEMMESELAGKQHEIEELNRELEE
MRVTYGTEGLQQLQEFEAAIKQRDGIITQLTANLQQARREKDETMREFLELTEQSQKLQI
QFQQLQASETLRNSTHSSTAADLLQAKQQILTHQQQLEEQDHLLEDYQKKKEDFTMQISF
LQEKIKVYEMEQDKKVENSNKEEIQEKETIIEELNTKIIEEEKKTLELKDKLTTADKLLG
ELQEQIVQKNQEIKNMKLELTNSKQKERQSSEEIKQLMGTVEELQKRNHKDSQFETDIVQ
RMEQETQRKLEQLRAELDEMYGQQIVQMKQELIRQHMAQMEEMKTRHKGEMENALRSYSN
ITVNEDQIKLMNVAINELNIKLQDTNSQKEKLKEELGLILEEKCALQRQLEDLVEELSFS
REQIQRARQTIAEQESKLNEAHKSLSTVEDLKAEIVSASESRKELELKHEAEVTNYKIKL
EMLEKEKNAVLDRMAESQEAELERLRTQLLFSHEEELSKLKEDLEIEHRINIEKLKDNLG
IHYKQQIDGLQNEMSQKIETMQFEKDNLITKQNQLILEISKLKDLQQSLVNSKSEEMTLQ
INELQKEIEILRQEEKEKGTLEQEVQELQLKTELLEKQMKEKENDLQEKFAQLEAENSIL
KDEKKTLEDMLKIHTPVSQEERLIFLDSIKSKSKDSVWEKEIEILIEENEDLKQQCIQLN
EEIEKQRNTFSFAEKNFEVNYQELQEEYACLLKVKDDLEDSKNKQELEYKSKLKALNEEL
HLQRINPTTVKMKSSVFDEDKTFVAETLEMGEVVEKDTTELMEKLEVTKREKLELSQRLS
DLSEQLKQKHGEISFLNEEVKSLKQEKEQVSLRCRELEIIINHNRAENVQSCDTQVSSLL
DGVVTMTSRGAEGSVSKVNKSFGEESKIMVEDKVSFENMTVGEESKQEQLILDHLPSVTK
ESSLRATQPSENDKLQKELNVLKSEQNDLRLQMEAQRICLSLVYSTHVDQVREYMENEKD
KALCSLKEELIFAQEEKIKELQKIHQLELQTMKTQETGDEGKPLHLLIGKLQKAVSEECS
YFLQTLCSVLGEYYTPALKCEVNAEDKENSGDYISENEDPELQDYRYEVQDFQENMHTLL
NKVTEEYNKLLVLQTRLSKIWGQQTDGMKLEFGEENLPKEETEFLSIHSQMTNLEDIDVN
HKSKLSSLQDLEKTKLEEQVQELESLISSLQQQLKETEQNYEAEIHCLQKRLQAVSESTV
PPSLPVDSVVITESDAQRTM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PJH3	0.080	0.301	6.370E-31	314	0.221	0.987	Q6PJH3.pdb.gz	Q6PJH3_HUMAN A kinase (PRKA) anchor protein (Yotiao) 9, isoform CRA_c OS=Homo sapiens OX=9606 GN=AKAP9 PE=1 SV=1
2	AFDB:Q96PV1	0.094	0.166	2.869E-4	704	0.109	0.216	Q96PV1.pdb.gz	Q96PV1_HUMAN KIAA1937 protein (Fragment) OS=Homo sapiens OX=9606 GN=KIAA1937 PE=2 SV=1
3	AFDB:Q388V1	0.061	0.080	4.011E-4	959	0.108	0.157	Q388V1.pdb.gz	Q388V1_TRYB2 NUP-1 protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0560 PE=4 SV=1
4	AFDB:A0A0B4K7K9	0.073	0.048	4.904E-4	2238	0.165	0.103	A0A0B4K7K9.pdb.gz	A0A0B4K7K9_DROME Bruchpilot, isoform J OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=1
5	AFDB:E7FFM2	0.052	0.045	4.904E-4	1622	0.129	0.111	E7FFM2.pdb.gz	E7FFM2_DANRE RB1-inducible coiled-coil 1 OS=Danio rerio OX=7955 GN=rb1cc1 PE=1 SV=2
6	AFDB:P55937	0.068	0.065	9.583E-4	1487	0.181	0.171	P55937.pdb.gz	GOGA3_MOUSE Golgin subfamily A member 3 OS=Mus musculus OX=10090 GN=Golga3 PE=1 SV=3
7	AFDB:Q9WUJ3	0.051	0.034	1.025E-3	2324	0.151	0.091	Q9WUJ3.pdb.gz	MYOME_RAT Myomegalin OS=Rattus norvegicus OX=10116 GN=Pde4dip PE=1 SV=1
8	AFDB:Q3UHU5	0.077	0.059	1.751E-3	1945	0.092	0.066	Q3UHU5.pdb.gz	MTCL1_MOUSE Microtubule cross-linking factor 1 OS=Mus musculus OX=10090 GN=Mtcl1 PE=1 SV=1
9	AFDB:Q6PHN1	0.084	0.109	2.141E-3	1016	0.148	0.204	Q6PHN1.pdb.gz	CCD57_MOUSE Coiled-coil domain-containing protein 57 OS=Mus musculus OX=10090 GN=Ccdc57 PE=1 SV=1
10	AFDB:A1IH00	0.065	0.085	3.201E-3	1028	0.136	0.186	A1IH00.pdb.gz	GOGA2_DANRE Golgin subfamily A member 2 OS=Danio rerio OX=7955 GN=golga2 PE=2 SV=1
11	PDB:7ungC4	0.047	0.230	3.687	219	0.014	0.091	7ungC4.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
12	PDB:2p22C	0.055	0.222	8.809	186	0.017	0.129	2p22C.pdb.gz
13	PDB:2rvqD	0.024	0.227	8.809	129	0.009	0.093	2rvqD.pdb.gz
14	PDB:7rroB0	0.046	0.286	8.809	189	0.016	0.116	7rroB0.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRF6	0.0	2778	3931	1.000	0.356	A0A0A0MRF6_HUMAN A-kinase anchoring protein 9 OS=Homo sapiens OX=9606 GN=AKAP9 PE=1 SV=2
2	A0A0G2K548	0.0	1728	3847	0.664	0.242	A0A0G2K548_RAT A-kinase anchoring protein 9 OS=Rattus norvegicus OX=10116 GN=Akap9 PE=1 SV=1
3	A0A8I5ZKK3	0.0	1729	3699	0.664	0.251	A0A8I5ZKK3_RAT A-kinase anchoring protein 9 OS=Rattus norvegicus OX=10116 GN=Akap9 PE=1 SV=1
4	A0A8I5ZWI9	0.0	1727	3787	0.664	0.246	A0A8I5ZWI9_RAT A-kinase anchoring protein 9 OS=Rattus norvegicus OX=10116 GN=Akap9 PE=1 SV=1
5	A0A8I6AIG6	0.0	1650	3796	0.639	0.236	A0A8I6AIG6_RAT A-kinase anchoring protein 9 OS=Rattus norvegicus OX=10116 GN=Akap9 PE=1 SV=1
6	A0A8I6GHX5	0.0	1692	3816	0.658	0.241	A0A8I6GHX5_RAT A-kinase anchoring protein 9 OS=Rattus norvegicus OX=10116 GN=Akap9 PE=1 SV=1
7	F1LPB4	0.0	1692	3771	0.658	0.244	F1LPB4_RAT A-kinase anchoring protein 9 OS=Rattus norvegicus OX=10116 GN=Akap9 PE=1 SV=2
8	Q6PJH3	0.0	635	314	0.221	0.987	Q6PJH3_HUMAN A kinase (PRKA) anchor protein (Yotiao) 9, isoform CRA_c OS=Homo sapiens OX=9606 GN=AKAP9 PE=1 SV=1
9	Q70FJ1	0.0	1692	3797	0.666	0.245	AKAP9_MOUSE A-kinase anchor protein 9 OS=Mus musculus OX=10090 GN=Akap9 PE=1 SV=2
10	Q99996	0.0	2778	3907	1.000	0.358	AKAP9_HUMAN A-kinase anchor protein 9 OS=Homo sapiens OX=9606 GN=AKAP9 PE=1 SV=4
11	P48725	7.80e-04	46.6	2898	0.017	0.008	PCNT_MOUSE Pericentrin OS=Mus musculus OX=10090 GN=Pcnt PE=1 SV=2
12	O95613	0.005	43.9	3336	0.016	0.007	PCNT_HUMAN Pericentrin OS=Homo sapiens OX=9606 GN=PCNT PE=1 SV=4
13	Q9VGE4	5.6	33.9	1135	0.059	0.073	Q9VGE4_DROME FI04457p OS=Drosophila melanogaster OX=7227 GN=GCC185 PE=1 SV=3
14	Q6AYX5	6.0	33.9	825	0.050	0.085	ODFP2_RAT Outer dense fiber protein 2 OS=Rattus norvegicus OX=10116 GN=Odf2 PE=1 SV=2
15	A3KGV1	6.4	33.5	830	0.050	0.084	ODFP2_MOUSE Outer dense fiber protein 2 OS=Mus musculus OX=10090 GN=Odf2 PE=1 SV=1
16	A1Z7Z9	9.0	33.1	1134	0.011	0.013	CP131_DROME Centrosomal protein of 131 kDa OS=Drosophila melanogaster OX=7227 GN=dila PE=2 SV=2
17	Q5BJF6	9.0	33.1	829	0.050	0.084	ODFP2_HUMAN Outer dense fiber protein 2 OS=Homo sapiens OX=9606 GN=ODF2 PE=1 SV=1
18	Q9JK25	9.1	33.1	1320	0.059	0.063	CLIP1_RAT CAP-Gly domain-containing linker protein 1 OS=Rattus norvegicus OX=10116 GN=Clip1 PE=1 SV=2
19	F1QKS0	9.3	33.1	1838	0.019	0.015	F1QKS0_DANRE Myosin VB OS=Danio rerio OX=7955 GN=cb1077 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348573

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000155840	0.999	Potassium voltage-gated channel subfamily KQT member 1
2	9606.ENSP00000343818	0.991	CDK5 regulatory subunit-associated protein 2
3	9606.ENSP00000358363	0.991	Myomegalin
4	9606.ENSP00000265717	0.985	cAMP-dependent protein kinase type II-beta regulatory subunit
5	9606.ENSP00000416097	0.975	Golgin subfamily A member 2
6	9606.ENSP00000265563	0.970	cAMP-dependent protein kinase type II-alpha regulatory subunit
7	9606.ENSP00000337255	0.969	Potassium voltage-gated channel subfamily E member 1
8	9606.ENSP00000359719	0.968	cAMP-dependent protein kinase catalytic subunit beta
9	9606.ENSP00000343325	0.958	Serine/threonine-protein kinase N1
10	9606.ENSP00000366488	0.945	cAMP-dependent protein kinase catalytic subunit gamma
11	9606.ENSP00000306253	0.937	Inositol 1,4,5-trisphosphate receptor type 1
12	9606.ENSP00000326031	0.936	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
13	9606.ENSP00000378699	0.931	Cyclin-dependent kinase 1
14	9606.ENSP00000306124	0.918	Protein kinase C epsilon type
15	9606.ENSP00000290277	0.916	Serine/threonine-protein kinase A-Raf
16	9606.ENSP00000323867	0.915	5'-AMP-activated protein kinase subunit gamma-1
17	9606.ENSP00000251849	0.909	RAF proto-oncogene serine/threonine-protein kinase
18	9606.ENSP00000417963	0.906	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
19	9606.ENSP00000371067	0.901	Tyrosine-protein kinase JAK2
20	9606.ENSP00000319060	0.900	Calcium/calmodulin-dependent protein kinase type II subunit gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051018	1.000	protein kinase A binding
GO:0034237	0.964	protein kinase A regulatory subunit binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.944	biological regulation
GO:0050896	0.915	response to stimulus
GO:0009987	0.841	cellular process
GO:0065009	0.830	regulation of molecular function
GO:0050789	0.785	regulation of biological process
GO:0071840	0.631	cellular component organization or biogenesis
GO:0016043	0.619	cellular component organization
GO:0050794	0.493	regulation of cellular process
GO:0007017	0.423	microtubule-based process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.993	endomembrane system
GO:0005794	0.984	Golgi apparatus
GO:0043232	0.941	intracellular non-membrane-bounded organelle
GO:0005886	0.798	plasma membrane
GO:0005856	0.793	cytoskeleton
GO:0005815	0.737	microtubule organizing center
GO:0005813	0.727	centrosome
GO:0005829	0.360	cytosol
GO:0031981	0.340	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]