StarFunc result for job id Q9BPW5

User Input

>input (248 residues)
MRLIQNMCTIAEYPAPGNAAASDCCVGAAGRRLVKIAVVGASGVGKTALVVRFLTKRFIG
DYERNAGNLYTRQVQIEGETLALQVQDTPGIQVHENSLSCSEQLNRCIRWADAVVIVFSI
TDYKSYELISQLHQHVQQLHLGTRLPVVVVANKADLLHIKQVDPQLGLQLASMLGCSFYE
VSVSENYNDVYSAFHVLCKEVSHKQQPSSTPEKRRTSLIPRPKSPNMQDLKRRFKQALSA
KVRTVTSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BPW5	1.000	1.000	7.635E-52	248	1.000	1.000	Q9BPW5.pdb.gz	RSLBB_HUMAN Ras-like protein family member 11B OS=Homo sapiens OX=9606 GN=RASL11B PE=1 SV=1
2	AFDB:Q6P0U3	0.701	0.713	5.149E-36	244	0.649	0.660	Q6P0U3.pdb.gz	RSLBB_DANRE Ras-like protein family member 11B OS=Danio rerio OX=7955 GN=rasl11b PE=2 SV=1
3	AFDB:Q6T310	0.671	0.687	5.222E-27	242	0.460	0.471	Q6T310.pdb.gz	RSLBA_HUMAN Ras-like protein family member 11A OS=Homo sapiens OX=9606 GN=RASL11A PE=1 SV=1
4	AFDB:Q6IMB1	0.665	0.681	8.108E-27	242	0.444	0.455	Q6IMB1.pdb.gz	RSLBA_MOUSE Ras-like protein family member 11A OS=Mus musculus OX=10090 GN=Rasl11a PE=1 SV=1
5	AFDB:P70426	0.649	0.731	6.932E-20	219	0.234	0.265	P70426.pdb.gz	RIT1_MOUSE GTP-binding protein Rit1 OS=Mus musculus OX=10090 GN=Rit1 PE=1 SV=1
6	AFDB:A0A024RAT4	0.650	0.804	1.146E-19	199	0.274	0.342	A0A024RAT4.pdb.gz
7	AFDB:G5EBK8	0.652	0.758	1.300E-19	212	0.230	0.269	G5EBK8.pdb.gz	G5EBK8_CAEEL GTP binding protein OS=Caenorhabditis elegans OX=6239 GN=ras-1 PE=1 SV=1
8	AFDB:P18613	0.645	0.851	1.569E-19	186	0.202	0.269	P18613.pdb.gz	RAPA_DICDI Ras-related protein rapA OS=Dictyostelium discoideum OX=44689 GN=rapA PE=1 SV=1
9	AFDB:P62070	0.626	0.754	1.671E-19	204	0.230	0.279	P62070.pdb.gz	RRAS2_HUMAN Ras-related protein R-Ras2 OS=Homo sapiens OX=9606 GN=RRAS2 PE=1 SV=1
10	AFDB:Q18246	0.633	0.826	2.288E-19	188	0.202	0.266	Q18246.pdb.gz	RAP1_CAEEL Ras-related protein Rap-1 OS=Caenorhabditis elegans OX=6239 GN=rap-1 PE=3 SV=1
11	PDB:6zizA	0.612	0.878	2.414E-18	170	0.210	0.306	6zizA.pdb.gz	Drugging all RAS isoforms with one pocket.
12	PDB:6kykC	0.623	0.902	9.033E-18	169	0.177	0.260	6kykC.pdb.gz	Shank3 Binds to and Stabilizes the Active Form of Rap1 and HRas GTPases via Its NTD-ANK Tandem with Distinct Mechanisms.
13	PDB:7sd0B	0.615	0.860	2.469E-17	174	0.218	0.310	7sd0B.pdb.gz	Structural basis for SHOC2 modulation of RAS signalling.
14	PDB:5szjA	0.606	0.845	5.368E-16	175	0.194	0.274	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
15	PDB:5szhB	0.594	0.823	6.086E-16	175	0.194	0.274	5szhB.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
16	PDB:1kaoA	0.621	0.905	1.071E-15	167	0.177	0.263	1kaoA.pdb.gz	Crystal structures of the small G protein Rap2A in complex with its substrate GTP, with GDP and with GTPgammaS.
17	PDB:6zqtA	0.633	0.894	1.467E-15	173	0.194	0.277	6zqtA.pdb.gz	Affinity maturation of the RLIP76 Ral binding domain to inform the design of stapled peptides targeting the Ral GTPases.
18	PDB:1vg8A	0.589	0.781	1.562E-15	184	0.177	0.239	1vg8A.pdb.gz	Structure of the Rab7:REP-1 complex: insights into the mechanism of Rab prenylation and choroideremia disease
19	PDB:3t5gA	0.612	0.867	1.771E-15	171	0.177	0.257	3t5gA.pdb.gz	Arl2-GTP and Arl3-GTP regulate a GDI-like transport system for farnesylated cargo.
20	PDB:2bovA	0.627	0.885	2.139E-15	173	0.185	0.266	2bovA.pdb.gz	Molecular Recognition of an Adp-Ribosylating Clostridium Botulinum C3 Exoenzyme by Rala Gtpase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BPW5	0.0	514	248	1.000	1.000	RSLBB_HUMAN Ras-like protein family member 11B OS=Homo sapiens OX=9606 GN=RASL11B PE=1 SV=1
2	Q922H7	7.98e-176	485	247	0.944	0.947	RSLBB_MOUSE Ras-like protein family member 11B OS=Mus musculus OX=10090 GN=Rasl11b PE=2 SV=1
3	Q6P0U3	5.58e-115	331	244	0.661	0.672	RSLBB_DANRE Ras-like protein family member 11B OS=Danio rerio OX=7955 GN=rasl11b PE=2 SV=1
4	Q6T310	5.06e-82	247	242	0.472	0.483	RSLBA_HUMAN Ras-like protein family member 11A OS=Homo sapiens OX=9606 GN=RASL11A PE=1 SV=1
5	Q6IMB1	3.24e-77	235	242	0.452	0.463	RSLBA_MOUSE Ras-like protein family member 11A OS=Mus musculus OX=10090 GN=Rasl11a PE=1 SV=1
6	Q96A58	2.51e-34	124	199	0.258	0.322	RERG_HUMAN Ras-related and estrogen-regulated growth inhibitor OS=Homo sapiens OX=9606 GN=RERG PE=1 SV=1
7	Q92963	1.78e-28	109	219	0.258	0.292	RIT1_HUMAN GTP-binding protein Rit1 OS=Homo sapiens OX=9606 GN=RIT1 PE=1 SV=1
8	P70426	1.66e-27	107	219	0.262	0.297	RIT1_MOUSE GTP-binding protein Rit1 OS=Mus musculus OX=10090 GN=Rit1 PE=1 SV=1
9	P32254	2.28e-25	100	194	0.246	0.314	RASS_DICDI Ras-like protein rasS OS=Dictyostelium discoideum OX=44689 GN=rasS PE=2 SV=1
10	Q9VM20	1.39e-24	101	328	0.250	0.189	Q9VM20_DROME RAS-like family 11 member A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5160 PE=1 SV=1
11	Q99578	1.67e-24	99.0	217	0.238	0.272	RIT2_HUMAN GTP-binding protein Rit2 OS=Homo sapiens OX=9606 GN=RIT2 PE=1 SV=1
12	B3DJU3	2.78e-24	98.2	211	0.242	0.284	B3DJU3_DANRE GTP-binding protein Rit1 OS=Danio rerio OX=7955 GN=si:ch211-93a2.3 PE=2 SV=1
13	P70425	8.27e-24	97.4	217	0.242	0.276	RIT2_MOUSE GTP-binding protein Rit2 OS=Mus musculus OX=10090 GN=Rit2 PE=1 SV=1
14	Q5BJQ5	1.05e-23	97.1	217	0.242	0.276	RIT2_RAT GTP-binding protein Rit2 OS=Rattus norvegicus OX=10116 GN=Rit2 PE=1 SV=1
15	P32253	2.43e-23	95.1	189	0.242	0.317	RASC_DICDI Ras-like protein rasC OS=Dictyostelium discoideum OX=44689 GN=rasC PE=1 SV=1
16	Q9NYN1	1.39e-22	95.1	266	0.226	0.211	RASLC_HUMAN Ras-like protein family member 12 OS=Homo sapiens OX=9606 GN=RASL12 PE=1 SV=1
17	Q7JMZ0	1.58e-22	95.1	264	0.222	0.208	Q7JMZ0_DROME RIC (Ras which interacts with Calmodulin) OS=Drosophila melanogaster OX=7227 GN=Ric PE=2 SV=1
18	Q5ANA9	5.84e-21	89.0	184	0.206	0.277	Q5ANA9_CANAL GTPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RHB1 PE=4 SV=1
19	P03967	1.95e-19	85.1	187	0.234	0.310	RASD_DICDI Ras-like protein rasD OS=Dictyostelium discoideum OX=44689 GN=rasD PE=1 SV=2
20	Q9N3F8	2.18e-19	85.5	213	0.198	0.230	Q9N3F8_CAEEL Small monomeric GTPase OS=Caenorhabditis elegans OX=6239 GN=ral-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	34	16.2	AAA ATPase domain
2	PF13238 AAA_18	2.4e+02	13.7	AAA domain
3	PF13401 AAA_22	42	15.9	AAA domain
4	PF13479 AAA_24	1.1e+02	14.0	AAA domain
5	PF00005 ABC_tran	3.7e+02	13.0	ABC transporter
6	PF04548 AIG1	11	16.9	AIG1 family
7	PF06029 AlkA_N	2.8e+02	13.2	AlkA N-terminal domain
8	PF03029 ATP_bind_1	15	16.9	Conserved hypothetical ATP binding protein
9	PF19993 DO-GTPase2	80	14.4	Double-GTPase 2
10	PF00350 Dynamin_N	4.9e+02	12.2	Dynamin family
11	PF02421 FeoB_N	0.0048	27.9	Ferrous iron transport protein B
12	PF00009 GTP_EFTU	1.3	20.0	Elongation factor Tu GTP binding domain
13	PF01926 MMR_HSR1	0.00015	33.2	50S ribosome-binding GTPase
14	PF00071 Ras	3.4e-25	100.0	Ras family
15	PF08477 Roc	3.5e-06	38.7	Ras of Complex, Roc, domain of DAPkinase
16	PF03193 RsgA_GTPase	0.012	27.0	RsgA GTPase
17	PF00735 Septin	56	14.5	Septin
18	PF05621 TniB	4.8e+02	11.6	Bacterial TniB protein
19	PF02458 Transferase	90	13.2	Transferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000248706

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353210	0.803	ADP-ribosylation factor-like protein 9
2	9606.ENSP00000386870	0.730	Doublecortin domain containing 2B
3	9606.ENSP00000355587	0.677	Cancer-related nucleoside-triphosphatase
4	9606.ENSP00000275954	0.642	Transmembrane protein 47
5	9606.ENSP00000347532	0.626	Shootin-1
6	9606.ENSP00000439625	0.582	Pleckstrin homology domain-containing family G member 5
7	9606.ENSP00000439287	0.576	Regulating synaptic membrane exocytosis protein 4
8	9606.ENSP00000295324	0.559	Cdc42 effector protein 3
9	9606.ENSP00000216446	0.544	Pleckstrin-2
10	9606.ENSP00000364430	0.542	Transcription factor Sp5
11	9606.ENSP00000369080	0.532	Sperm flagellar protein 1
12	9606.ENSP00000317376	0.531	Mitochondrial ribosomal protein S11
13	9606.ENSP00000265881	0.529	Oligoribonuclease, mitochondrial
14	9606.ENSP00000336693	0.527	Belongs to the serine esterase family
15	9606.ENSP00000341071	0.526	Rho guanine nucleotide exchange factor 3
16	9606.ENSP00000307567	0.525	Glutamine--tRNA ligase
17	9606.ENSP00000279249	0.521	Cdc42 effector protein 2
18	9606.ENSP00000285046	0.516	FYVE, RhoGEF and PH domain-containing protein 5
19	9606.ENSP00000241051	0.512	DEP domain containing 7
20	9606.ENSP00000360561	0.511	Ectonucleoside triphosphate diphosphohydrolase 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003824	0.520	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.985	biological regulation
GO:0050794	0.982	regulation of cellular process
GO:1903844	0.912	regulation of cellular response to transforming growth factor beta stimulus
GO:0090092	0.889	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0017015	0.860	regulation of transforming growth factor beta receptor signaling pathway
GO:0048523	0.858	negative regulation of cellular process
GO:0009968	0.795	negative regulation of signal transduction
GO:0009987	0.786	cellular process
GO:0030512	0.776	negative regulation of transforming growth factor beta receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005737	0.995	cytoplasm
GO:0005634	0.977	nucleus
GO:0043232	0.972	intracellular non-membrane-bounded organelle
GO:0070013	0.962	intracellular organelle lumen
GO:0016020	0.851	membrane
GO:0031981	0.747	nuclear lumen
GO:0005829	0.465	cytosol
GO:0005886	0.364	plasma membrane
GO:0012505	0.347	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]