StarFunc result for job id Q9BPX3

User Input

>input (1015 residues)
MGAERRLLSIKEAFRLAQQPHQNQAKLVVALSRTYRTMDDKTVFHEEFIHYLKYVMVVYK
REPAVERVIEFAAKFVTSFHQSDMEDDEEEEDGGLLNYLFTFLLKSHEANSNAVRFRVCL
LINKLLGSMPENAQIDDDVFDKINKAMLIRLKDKIPNVRIQAVLALSRLQDPKDDECPVV
NAYATLIENDSNPEVRRAVLSCIAPSAKTLPKIVGRTKDVKEAVRKLAYQVLAEKVHMRA
MSIAQRVMLLQQGLNDRSDAVKQAMQKHLLQGWLRFSEGNILELLHRLDVENSSEVAVSV
LNALFSITPLSELVGLCKNNDGRKLIPVETLTPEIALYWCALCEYLKSKGDEGEEFLEQI
LPEPVVYADYLLSYIQSIPVVNEEHRGDFSYIGNLMTKEFIGQQLILIIKSLDTSEEGGR
KKLLAVLQEILILPTIPISLVSFLVERLLHIIIDDNKRTQIVTEIISEIRAPIVTVGVNN
DPADVRKKELKMAEIKVKLIEAKEALENCITLQDFNRASELKEEIKALEDARINLLKETE
QLEIKEVHIEKNDAETLQKCLILCYELLKQMSISTGLSATMNGIIESLILPGIISIHPVV
RNLAVLCLGCCGLQNQDFARKHFVLLLQVLQIDDVTIKISALKAIFDQLMTFGIEPFKTK
KIKTLHCEGTEINSDDEQESKEVEETATAKNVLKLLSDFLDSEVSELRTGAAEGLAKLMF
SGLLVSSRILSRLILLWYNPVTEEDVQLRHCLGVFFPVFAYASRTNQECFEEAFLPTLQT
LANAPASSPLAEIDITNVAELLVDLTRPSGLNPQAKTSQDYQALTVHDNLAMKICNEILT
SPCSPEIRVYTKALSSLELSSHLAKDLLVLLNEILEQVKDRTCLRALEKIKIQLEKGNKE
FGDQAEAAQDATLTTTTFQNEDEKNKEVYMTPLRGVKATQASKSTQLKTNRGQRKVTVSA
RTNRRCQTAEADSESDHEVPEPESEMKMRLPRRAKTAALEKSKLNLAQFLNEDLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BPX3	1.000	1.000	0.000	1015	1.000	1.000	Q9BPX3.pdb.gz	CND3_HUMAN Condensin complex subunit 3 OS=Homo sapiens OX=9606 GN=NCAPG PE=1 SV=1
2	AFDB:E9PWG6	0.823	0.831	3.605E-101	1004	0.813	0.822	E9PWG6.pdb.gz	E9PWG6_MOUSE Non-SMC condensin I complex, subunit G OS=Mus musculus OX=10090 GN=Ncapg PE=1 SV=1
3	AFDB:Q9YHB5	0.789	0.775	4.264E-83	1034	0.614	0.603	Q9YHB5.pdb.gz	CND3_XENLA Condensin complex subunit 3 OS=Xenopus laevis OX=8355 GN=ncapg PE=1 SV=1
4	AFDB:F1QJY8	0.756	0.765	1.277E-72	1003	0.514	0.520	F1QJY8.pdb.gz	F1QJY8_DANRE Condensin complex subunit 3 OS=Danio rerio OX=7955 GN=im:7149538 PE=1 SV=1
5	AFDB:Q06680	0.686	0.673	1.519E-33	1035	0.210	0.206	Q06680.pdb.gz	CND3_YEAST Condensin complex subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YCG1 PE=1 SV=2
6	AFDB:Q10429	0.665	0.764	4.092E-33	875	0.235	0.273	Q10429.pdb.gz	CND3_SCHPO Condensin complex subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cnd3 PE=1 SV=1
7	PDB:5oqrA	0.661	0.880	6.033E-31	751	0.223	0.301	5oqrA.pdb.gz
8	AFDB:F4K790	0.692	0.670	1.320E-29	1051	0.230	0.222	F4K790.pdb.gz	F4K790_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=EMB2656 PE=1 SV=1
9	PDB:7qfwA	0.684	0.834	2.583E-28	823	0.197	0.243	7qfwA.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
10	AFDB:Q6ZQK0	0.337	0.250	3.274E-12	1506	0.165	0.111	Q6ZQK0.pdb.gz	CNDD3_MOUSE Condensin-2 complex subunit D3 OS=Mus musculus OX=10090 GN=Ncapd3 PE=1 SV=3
11	AFDB:Q9DGN0	0.355	0.318	5.928E-11	1194	0.149	0.126	Q9DGN0.pdb.gz	STAG2_XENLA Cohesin subunit SA-2 OS=Xenopus laevis OX=8355 GN=stag2 PE=1 SV=1
12	AFDB:Q9YHY6	0.344	0.270	3.554E-10	1364	0.152	0.113	Q9YHY6.pdb.gz	CND1_XENLA Condensin complex subunit 1 OS=Xenopus laevis OX=8355 GN=ncapd2 PE=1 SV=1
13	PDB:6zz6D	0.336	0.328	3.926E-9	1050	0.123	0.119	6zz6D.pdb.gz	Transport of DNA within cohesin involves clamping on top of engaged heads by Scc2 and entrapment within the ring by Scc3.
14	PDB:7qenD	0.380	0.371	7.224E-9	1050	0.124	0.120	7qenD.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
15	PDB:4jlqA	0.218	0.258	2.540E-8	840	0.129	0.156	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
16	PDB:6xu2A	0.183	0.175	5.045E-8	1091	0.131	0.122	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
17	PDB:3w3zA	0.167	0.168	5.241E-8	1013	0.124	0.124	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
18	PDB:1qgkA	0.221	0.249	7.108E-8	876	0.123	0.143	1qgkA.pdb.gz
19	PDB:6wg3D	0.287	0.302	8.935E-8	932	0.121	0.132	6wg3D.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
20	PDB:6qnxA	0.350	0.372	1.708E-7	928	0.107	0.117	6qnxA.pdb.gz	The structural basis for cohesin-CTCF-anchored loops.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RQA7	0.0	1004	661	0.505	0.776	B2RQA7_MOUSE Ncapg protein OS=Mus musculus OX=10090 GN=Ncapg PE=2 SV=1
2	E9PWG6	0.0	1679	1004	0.822	0.831	E9PWG6_MOUSE Non-SMC condensin I complex, subunit G OS=Mus musculus OX=10090 GN=Ncapg PE=1 SV=1
3	F1QJY8	0.0	966	1003	0.515	0.521	F1QJY8_DANRE Condensin complex subunit 3 OS=Danio rerio OX=7955 GN=im:7149538 PE=1 SV=1
4	Q9BPX3	0.0	2072	1015	1.000	1.000	CND3_HUMAN Condensin complex subunit 3 OS=Homo sapiens OX=9606 GN=NCAPG PE=1 SV=1
5	Q9YHB5	0.0	1198	1034	0.617	0.605	CND3_XENLA Condensin complex subunit 3 OS=Xenopus laevis OX=8355 GN=ncapg PE=1 SV=1
6	Q9JK28	3.65e-154	459	286	0.225	0.797	Q9JK28_MOUSE UVR domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Ncapg PE=2 SV=1
7	B3DN53	6.74e-53	204	1299	0.249	0.195	B3DN53_DROME Chromosome associated protein G, isoform G OS=Drosophila melanogaster OX=7227 GN=Cap-G PE=1 SV=1
8	A1Z987	1.33e-52	203	1351	0.249	0.187	A1Z987_DROME Chromosome associated protein G, isoform F OS=Drosophila melanogaster OX=7227 GN=Cap-G PE=1 SV=2
9	Q10429	3.94e-52	200	875	0.229	0.265	CND3_SCHPO Condensin complex subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cnd3 PE=1 SV=1
10	F4K790	1.26e-39	162	1051	0.122	0.118	F4K790_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=EMB2656 PE=1 SV=1
11	Q06680	1.72e-28	126	1035	0.122	0.120	CND3_YEAST Condensin complex subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YCG1 PE=1 SV=2
12	Q57ZK1	1.83e-06	54.7	1061	0.061	0.058	Q57ZK1_TRYB2 Nuclear condensin complex subunit 3 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27C5.700 PE=3 SV=1
13	P11716	2.8	34.7	5037	0.030	0.006	RYR1_RABIT Ryanodine receptor 1 OS=Oryctolagus cuniculus OX=9986 GN=RYR1 PE=1 SV=1
14	A0A060WZC7	4.5	33.9	4791	0.030	0.006	A0A060WZC7_ONCMY Skeletal muscle ryanodine receptor OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00004066001 PE=4 SV=1
15	A5HEI1	6.5	33.1	1846	0.030	0.016	SCC2_ARATH Sister chromatid cohesion protein SCC2 OS=Arabidopsis thaliana OX=3702 GN=SCC2 PE=1 SV=1
16	Q9P8E3	7.8	32.7	479	0.040	0.086	SC61A_CANAL Protein transport protein SEC61 subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SEC61 PE=3 SV=2
17	A2AKX3	8.8	32.7	2646	0.025	0.009	SETX_MOUSE Probable helicase senataxin OS=Mus musculus OX=10090 GN=Setx PE=1 SV=1
18	Q9BXX0	9.7	32.7	1053	0.035	0.034	EMIL2_HUMAN EMILIN-2 OS=Homo sapiens OX=9606 GN=EMILIN2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12717 Cnd1	5.5	18.5	non-SMC mitotic condensation complex subunit 1
2	PF12719 Cnd3	6.2e-82	286.7	Nuclear condensing complex subunits, C-term domain
3	PF02985 HEAT	0.0029	28.7	HEAT repeat
4	PF13646 HEAT_2	4.8e-07	41.4	HEAT repeats
5	PF13513 HEAT_EZ	2.6e+02	13.6	HEAT-like repeat
6	PF02151 UVR	68	14.6	UvrB/uvrC motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000251496

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000240423	0.999	Condensin complex subunit 2
2	9606.ENSP00000286398	0.999	Structural maintenance of chromosomes protein 2
3	9606.ENSP00000325017	0.999	Condensin complex subunit 1
4	9606.ENSP00000349961	0.999	Structural maintenance of chromosomes protein 4
5	9606.ENSP00000378699	0.999	Cyclin-dependent kinase 1
6	9606.ENSP00000313950	0.997	Aurora kinase B
7	9606.ENSP00000433681	0.997	Condensin-2 complex subunit D3
8	9606.ENSP00000288207	0.996	G2/mitotic-specific cyclin-B2
9	9606.ENSP00000356379	0.995	Abnormal spindle-like microcephaly-associated protein
10	9606.ENSP00000256442	0.994	G2/mitotic-specific cyclin-B1
11	9606.ENSP00000260731	0.993	Kinesin-like protein KIF11
12	9606.ENSP00000296509	0.993	Mitotic spindle assembly checkpoint protein MAD2A
13	9606.ENSP00000358813	0.993	Dual specificity protein kinase TTK
14	9606.ENSP00000261597	0.991	Kinetochore protein NDC80 homolog
15	9606.ENSP00000411532	0.990	DNA topoisomerase 2-alpha
16	9606.ENSP00000453403	0.990	Nucleolar and spindle-associated protein 1
17	9606.ENSP00000302530	0.988	Mitotic checkpoint serine/threonine-protein kinase BUB1
18	9606.ENSP00000324020	0.988	Kinesin-like protein KIF15
19	9606.ENSP00000247191	0.987	Disks large-associated protein 5
20	9606.ENSP00000377793	0.986	Protein regulator of cytokinesis 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0051276	0.993	chromosome organization
GO:0007059	0.989	chromosome segregation
GO:1903047	0.989	mitotic cell cycle process
GO:0048285	0.982	organelle fission
GO:0000819	0.969	sister chromatid segregation
GO:0000070	0.955	mitotic sister chromatid segregation
GO:0048522	0.887	positive regulation of cellular process
GO:0033044	0.817	regulation of chromosome organization
GO:0030261	0.675	chromosome condensation
GO:0010564	0.450	regulation of cell cycle process
GO:0010638	0.364	positive regulation of organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005737	0.999	cytoplasm
GO:0005694	0.999	chromosome
GO:0005829	0.990	cytosol
GO:0000796	0.977	condensin complex
GO:0005654	0.968	nucleoplasm
GO:0016020	0.938	membrane
GO:0098687	0.580	chromosomal region
GO:0000793	0.514	condensed chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]